BLASTX nr result
ID: Coptis23_contig00007369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00007369 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637312.1| Monoglyceride lipase [Medicago truncatula] g... 55 5e-06 ref|XP_003636968.1| Monoglyceride lipase [Medicago truncatula] g... 55 5e-06 ref|XP_003636967.1| Monoglyceride lipase [Medicago truncatula] g... 55 5e-06 ref|XP_003636966.1| Monoglyceride lipase [Medicago truncatula] g... 55 5e-06 ref|XP_002280343.2| PREDICTED: uncharacterized protein LOC100261... 55 6e-06 >ref|XP_003637312.1| Monoglyceride lipase [Medicago truncatula] gi|355503247|gb|AES84450.1| Monoglyceride lipase [Medicago truncatula] Length = 209 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -1 Query: 124 RIEGITNELQKILDANKNMDYAPARRCVRVAFKDVQLGIDH 2 R G+ NELQKILDAN MD+ ARR R AFKDVQLGIDH Sbjct: 4 RFPGVDNELQKILDAN--MDHVSARRQAREAFKDVQLGIDH 42 >ref|XP_003636968.1| Monoglyceride lipase [Medicago truncatula] gi|355502903|gb|AES84106.1| Monoglyceride lipase [Medicago truncatula] Length = 380 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -1 Query: 124 RIEGITNELQKILDANKNMDYAPARRCVRVAFKDVQLGIDH 2 R G+ NELQKILDAN MD+ ARR R AFKDVQLGIDH Sbjct: 38 RFPGVDNELQKILDAN--MDHVSARRQAREAFKDVQLGIDH 76 >ref|XP_003636967.1| Monoglyceride lipase [Medicago truncatula] gi|355502902|gb|AES84105.1| Monoglyceride lipase [Medicago truncatula] Length = 333 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -1 Query: 124 RIEGITNELQKILDANKNMDYAPARRCVRVAFKDVQLGIDH 2 R G+ NELQKILDAN MD+ ARR R AFKDVQLGIDH Sbjct: 4 RFPGVDNELQKILDAN--MDHVSARRQAREAFKDVQLGIDH 42 >ref|XP_003636966.1| Monoglyceride lipase [Medicago truncatula] gi|355502901|gb|AES84104.1| Monoglyceride lipase [Medicago truncatula] Length = 346 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -1 Query: 124 RIEGITNELQKILDANKNMDYAPARRCVRVAFKDVQLGIDH 2 R G+ NELQKILDAN MD+ ARR R AFKDVQLGIDH Sbjct: 4 RFPGVDNELQKILDAN--MDHVSARRQAREAFKDVQLGIDH 42 >ref|XP_002280343.2| PREDICTED: uncharacterized protein LOC100261782 [Vitis vinifera] Length = 409 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -1 Query: 139 MGKGIRIEGITNELQKILDANKNMDYAPARRCVRVAFKDVQLGIDH 2 M ++EG+ ELQKILDA MD APARR R AFK++QLGIDH Sbjct: 63 MAPAAKLEGVDKELQKILDAK--MDEAPARRRAREAFKEIQLGIDH 106