BLASTX nr result
ID: Coptis23_contig00006993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00006993 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109553.1| hypothetical protein Poptr_cp075 [Populus tr... 161 4e-38 ref|XP_003638717.1| Cell wall-associated hydrolase [Medicago tru... 85 7e-15 ref|XP_003611001.1| hypothetical protein MTR_5g009380 [Medicago ... 59 4e-07 >ref|YP_001109553.1| hypothetical protein Poptr_cp075 [Populus trichocarpa] gi|134093265|ref|YP_001109566.1| hypothetical protein Poptr_cp088 [Populus trichocarpa] gi|133712114|gb|ABO36757.1| hypothetical protein Poptr_cp075 [Populus trichocarpa] gi|133712127|gb|ABO36770.1| hypothetical protein Poptr_cp088 [Populus trichocarpa] Length = 86 Score = 161 bits (408), Expect = 4e-38 Identities = 73/81 (90%), Positives = 76/81 (93%), Gaps = 1/81 (1%) Frame = +3 Query: 93 MAWCGSSTPRTPEYRTMNEERHEIKAYWLVIVRPPFLTGGDTKGLCPSIPWIDREGGQSF 272 M WCGSSTPRTPEYRTMNEERHE KAYWLVIVRP FLTGGDTKGLCPSI WIDREGG+SF Sbjct: 1 MDWCGSSTPRTPEYRTMNEERHERKAYWLVIVRPQFLTGGDTKGLCPSITWIDREGGRSF 60 Query: 273 W-FFHVVKELNNENRWRMPDR 332 W FFHVVKELNN+NRWR+PDR Sbjct: 61 WFFFHVVKELNNKNRWRVPDR 81 >ref|XP_003638717.1| Cell wall-associated hydrolase [Medicago truncatula] gi|355504652|gb|AES85855.1| Cell wall-associated hydrolase [Medicago truncatula] Length = 385 Score = 84.7 bits (208), Expect = 7e-15 Identities = 41/77 (53%), Positives = 47/77 (61%) Frame = +3 Query: 93 MAWCGSSTPRTPEYRTMNEERHEIKAYWLVIVRPPFLTGGDTKGLCPSIPWIDREGGQSF 272 M WCGSSTPRTPEYRTMNE + KA ++P R+GGQ F Sbjct: 1 MDWCGSSTPRTPEYRTMNEVKRTPKA--------------------SALPSYSRDGGQRF 40 Query: 273 WFFHVVKELNNENRWRM 323 WFFHVVKELNN+NRWR+ Sbjct: 41 WFFHVVKELNNQNRWRL 57 >ref|XP_003611001.1| hypothetical protein MTR_5g009380 [Medicago truncatula] gi|355512336|gb|AES93959.1| hypothetical protein MTR_5g009380 [Medicago truncatula] Length = 54 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +3 Query: 234 SIPWIDREGGQSFWFFHVVKELNNENRWRMPDR 332 ++P R+GGQ FWFFHVVKELNN+NRWR+ DR Sbjct: 12 ALPSYSRDGGQRFWFFHVVKELNNQNRWRLSDR 44