BLASTX nr result
ID: Coptis23_contig00006644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00006644 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516740.1| leucine-rich repeat containing protein, puta... 62 5e-08 ref|XP_002302957.1| cc-nbs-lrr resistance protein [Populus trich... 60 1e-07 ref|XP_002446300.1| hypothetical protein SORBIDRAFT_06g013840 [S... 60 2e-07 ref|XP_002302958.1| cc-nbs-lrr resistance protein [Populus trich... 59 3e-07 ref|XP_002336038.1| cc-nbs-lrr resistance protein [Populus trich... 59 3e-07 >ref|XP_002516740.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223544113|gb|EEF45638.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1104 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/55 (52%), Positives = 40/55 (72%) Frame = +2 Query: 35 GEEKRKRIESVLDGLQPHTNLAELHIEDYEGNKFPSWMSSNTALPNLVKLELRNC 199 GE+ E VLDG QPH+NL +L I Y+G+KF SWM ++ +LPNLV++EL +C Sbjct: 726 GEDSSNLSEEVLDGCQPHSNLKKLSIRKYQGSKFASWM-TDLSLPNLVEIELVDC 779 >ref|XP_002302957.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222844683|gb|EEE82230.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1085 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = +2 Query: 65 VLDGLQPHTNLAELHIEDYEGNKFPSWMSSNTALPNLVKLELRNC 199 VLD LQPH+NL +L IE Y G++FP+WM N LPNLV++ELR+C Sbjct: 743 VLDRLQPHSNLKKLSIEGYGGSRFPNWM-MNLMLPNLVEMELRDC 786 >ref|XP_002446300.1| hypothetical protein SORBIDRAFT_06g013840 [Sorghum bicolor] gi|241937483|gb|EES10628.1| hypothetical protein SORBIDRAFT_06g013840 [Sorghum bicolor] Length = 793 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +2 Query: 23 QDAAGEEKRKRIESVLDGLQPHTNLAELHIEDYEGNKFPSWM-SSNTALPNLVKLELRNC 199 +D + K E VL+GL+PH NL L I YEG +FP+WM S+ +LPNLV L L NC Sbjct: 557 EDEGEDSKDVADEQVLEGLKPHVNLQVLTIRGYEGRRFPAWMQGSSPSLPNLVTLTLDNC 616 >ref|XP_002302958.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222844684|gb|EEE82231.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1086 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +2 Query: 65 VLDGLQPHTNLAELHIEDYEGNKFPSWMSSNTALPNLVKLELRNC 199 VLD LQPH+NL L I++Y G++FP+WM N LPNLV+L+LR+C Sbjct: 744 VLDRLQPHSNLKTLRIDEYGGSRFPNWM-MNLMLPNLVELKLRDC 787 >ref|XP_002336038.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222839627|gb|EEE77950.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1052 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +2 Query: 65 VLDGLQPHTNLAELHIEDYEGNKFPSWMSSNTALPNLVKLELRNC 199 VLD LQPH+NL L I++Y G++FP+WM N LPNLV+L+LR+C Sbjct: 710 VLDRLQPHSNLKTLRIDEYGGSRFPNWM-MNLMLPNLVELKLRDC 753