BLASTX nr result
ID: Coptis23_contig00005615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00005615 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT40498.2| hypothetical protein SDM1_19t00009 [Solanum demis... 56 3e-06 >gb|AAT40498.2| hypothetical protein SDM1_19t00009 [Solanum demissum] Length = 267 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -2 Query: 165 GRGKGTGFLSKGRGAPGSGWTGAGFDVDGRT 73 GRGKG G + KGRG+ G GWTGAGFDVDGR+ Sbjct: 237 GRGKGIGIIPKGRGSQGPGWTGAGFDVDGRS 267