BLASTX nr result
ID: Coptis23_contig00005607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00005607 (1302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150383.1| PREDICTED: proteinaceous RNase P 1, chloropl... 54 6e-06 >ref|XP_004150383.1| PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like [Cucumis sativus] gi|449506617|ref|XP_004162799.1| PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like [Cucumis sativus] Length = 633 Score = 54.3 bits (129), Expect(2) = 6e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +1 Query: 316 KWIDYYGPFEAVIVDTADMSLFSQRKYSPSKVN 414 KW++YYGPFEAVI D A++ LFSQRK++PSKVN Sbjct: 433 KWLEYYGPFEAVI-DAANVGLFSQRKFAPSKVN 464 Score = 23.1 bits (48), Expect(2) = 6e-06 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 147 VKLQ*MEANNFAKSVATIASKR 212 + L +E NFA+SVA I ++R Sbjct: 401 IDLDPIETENFAESVAAIVTQR 422