BLASTX nr result
ID: Coptis23_contig00005435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00005435 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522377.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 ref|XP_002310770.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >ref|XP_002522377.1| conserved hypothetical protein [Ricinus communis] gi|223538455|gb|EEF40061.1| conserved hypothetical protein [Ricinus communis] Length = 178 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 5 SLDFLKKRKMQVSRSHSVLENSNQALRLISSCGLLRKK 118 SL FLKK+KMQVSRS SVL NSNQALRLIS+ GLL KK Sbjct: 141 SLQFLKKKKMQVSRSSSVLNNSNQALRLISTLGLLSKK 178 >ref|XP_002310770.1| predicted protein [Populus trichocarpa] gi|222853673|gb|EEE91220.1| predicted protein [Populus trichocarpa] Length = 184 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +2 Query: 5 SLDFLKKRKMQVSRSHSVLENSNQALRLISSCGLLRKK 118 SL+FLKK+KMQ+SRS SVL N NQALRLIS+ GL KK Sbjct: 147 SLEFLKKKKMQLSRSSSVLNNPNQALRLISTSGLFSKK 184