BLASTX nr result
ID: Coptis23_contig00005391
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00005391 (782 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531411.1| conserved hypothetical protein [Ricinus comm... 56 8e-06 >ref|XP_002531411.1| conserved hypothetical protein [Ricinus communis] gi|223529004|gb|EEF30995.1| conserved hypothetical protein [Ricinus communis] Length = 500 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -1 Query: 467 SHKSPKSNIPGSAKRLKVKEKAVLADVFSKYGEKGSLA 354 + K+PK IPGSAKRLK++EKAVL DVFSKYG + ++A Sbjct: 403 AEKAPKLEIPGSAKRLKIREKAVLTDVFSKYGSQSAIA 440