BLASTX nr result
ID: Coptis23_contig00005333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00005333 (687 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530545.1| protein binding protein, putative [Ricinus c... 138 9e-31 ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|2... 134 1e-29 ref|XP_002268131.1| PREDICTED: uncharacterized protein LOC100261... 119 4e-25 emb|CAN66246.1| hypothetical protein VITISV_033016 [Vitis vinifera] 119 4e-25 dbj|BAF80453.1| DC1 domain containing protein [Nicotiana tabacum] 117 2e-24 >ref|XP_002530545.1| protein binding protein, putative [Ricinus communis] gi|223529907|gb|EEF31836.1| protein binding protein, putative [Ricinus communis] Length = 324 Score = 138 bits (348), Expect = 9e-31 Identities = 63/110 (57%), Positives = 75/110 (68%), Gaps = 5/110 (4%) Frame = +3 Query: 3 GFRYNCSTCNLDFHILCAAMPPSLRHQAHPHSLNLAFNPPYQTKGFSCDICQKLGSNRWL 182 GF Y+C+ C+ D H CA P SL +Q HPH L L F+PPY TKGFSCDICQK+GSN WL Sbjct: 99 GFGYHCNHCSFDIHTTCAQNPLSLTNQFHPHLLQLTFDPPYHTKGFSCDICQKIGSNHWL 158 Query: 183 YRCNACDFDVHLNCA-----TTKPRVSEIQHQITVPQPQPPLKNHNSFPG 317 YRC C+FD HL CA ++S+ Q Q PQPQP L++HNSFPG Sbjct: 159 YRCAPCEFDAHLECAMGAVPVAAQQLSQYQPQ-PQPQPQPQLQHHNSFPG 207 Score = 70.5 bits (171), Expect = 3e-10 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 1/76 (1%) Frame = +3 Query: 3 GFRYNCSTCNLDFHILCAAMPPSLRHQAHP-HSLNLAFNPPYQTKGFSCDICQKLGSNRW 179 G+ Y+C+ CN H+ C+ +P + H +HP H+L+L +P Y FSCD C G + Sbjct: 42 GWMYSCNPCNFTLHLSCSQLPSLITHPSHPNHTLDLLPSPIYPNGVFSCDACGH-GGLGF 100 Query: 180 LYRCNACDFDVHLNCA 227 Y CN C FD+H CA Sbjct: 101 GYHCNHCSFDIHTTCA 116 >ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|222858396|gb|EEE95943.1| predicted protein [Populus trichocarpa] Length = 326 Score = 134 bits (338), Expect = 1e-29 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 2/93 (2%) Frame = +3 Query: 3 GFRYNCSTCNLDFHILCAAMPPSLRHQAHPHSLNLAFNPPYQTKGFSCDICQKLGSNRWL 182 GF Y+C+TC+ D H++CA P SL HQ+HPH LNLAF PPYQTKGFSCDIC K+GSN WL Sbjct: 98 GFNYHCTTCDFDVHMMCATNPLSLAHQSHPHQLNLAFYPPYQTKGFSCDICHKIGSNHWL 157 Query: 183 YRCNACDFDVHLNCA--TTKPRVSEIQHQITVP 275 YRC+AC+FD H+ CA + +QH ++P Sbjct: 158 YRCSACEFDAHMKCAMSVNNTPLPHVQHSNSLP 190 Score = 75.5 bits (184), Expect = 9e-12 Identities = 36/87 (41%), Positives = 44/87 (50%), Gaps = 1/87 (1%) Frame = +3 Query: 3 GFRYNCSTCNLDFHILCAAMPPSLRHQAHP-HSLNLAFNPPYQTKGFSCDICQKLGSNRW 179 G+ Y+C CN HI C MP + H HP H L L P Y F+CD C L N + Sbjct: 41 GWMYSCKPCNFTLHISCTQMPTLITHPCHPIHPLTLFSTPVYPGGSFNCDGC-GLQGNGF 99 Query: 180 LYRCNACDFDVHLNCATTKPRVSEIQH 260 Y C CDFDVH+ CAT ++ H Sbjct: 100 NYHCTTCDFDVHMMCATNPLSLAHQSH 126 >ref|XP_002268131.1| PREDICTED: uncharacterized protein LOC100261320 [Vitis vinifera] Length = 360 Score = 119 bits (299), Expect = 4e-25 Identities = 46/79 (58%), Positives = 60/79 (75%) Frame = +3 Query: 3 GFRYNCSTCNLDFHILCAAMPPSLRHQAHPHSLNLAFNPPYQTKGFSCDICQKLGSNRWL 182 GF Y+C CN+D HILCA+ P L HQ+H H L L+F+PPY K FSCDIC+++G++ WL Sbjct: 103 GFSYHCGVCNIDLHILCASKPLFLNHQSHHHRLALSFSPPYHNKSFSCDICRQIGTSHWL 162 Query: 183 YRCNACDFDVHLNCATTKP 239 YRC+ C+FD HL+CAT P Sbjct: 163 YRCDECEFDAHLSCATATP 181 >emb|CAN66246.1| hypothetical protein VITISV_033016 [Vitis vinifera] Length = 366 Score = 119 bits (299), Expect = 4e-25 Identities = 46/79 (58%), Positives = 60/79 (75%) Frame = +3 Query: 3 GFRYNCSTCNLDFHILCAAMPPSLRHQAHPHSLNLAFNPPYQTKGFSCDICQKLGSNRWL 182 GF Y+C CN+D HILCA+ P L HQ+H H L L+F+PPY K FSCDIC+++G++ WL Sbjct: 109 GFSYHCGVCNIDLHILCASKPLFLNHQSHHHRLALSFSPPYHNKSFSCDICRQIGTSHWL 168 Query: 183 YRCNACDFDVHLNCATTKP 239 YRC+ C+FD HL+CAT P Sbjct: 169 YRCDECEFDAHLSCATATP 187 >dbj|BAF80453.1| DC1 domain containing protein [Nicotiana tabacum] Length = 212 Score = 117 bits (294), Expect = 2e-24 Identities = 50/102 (49%), Positives = 61/102 (59%), Gaps = 2/102 (1%) Frame = +3 Query: 3 GFRYNCSTCNLDFHILCAAMPPSLRHQAHPHSLNLAFNPPYQTKGFSCDICQKLGSNRWL 182 GF Y+C TC D HILCA P + H +H H L+L F+PPY K F CDIC+K+G+N WL Sbjct: 106 GFSYHCKTCGTDLHILCAVFPQCVTHWSHHHQLDLKFSPPYPGKSFCCDICKKVGTNHWL 165 Query: 183 YRCNACDFDVHLNCATTK--PRVSEIQHQITVPQPQPPLKNH 302 YRC C FD HLNC T + P S I T + P + H Sbjct: 166 YRCQTCGFDAHLNCTTLQAPPHQSHIHQNPTTSRSAPQQQQH 207