BLASTX nr result
ID: Coptis23_contig00005126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00005126 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277445.2| PREDICTED: splicing factor U2af small subuni... 58 7e-07 >ref|XP_002277445.2| PREDICTED: splicing factor U2af small subunit B-like [Vitis vinifera] Length = 343 Score = 58.2 bits (139), Expect = 7e-07 Identities = 35/74 (47%), Positives = 43/74 (58%), Gaps = 10/74 (13%) Frame = -1 Query: 193 GEQSSIPGREGSAERRAKIELWNREREQAEAA---DDSRNANTNETSCCSRDRGEYH--- 32 G ++ P REGSAERRAKIE WNREREQAEA D+S + N N + +D +Y+ Sbjct: 267 GRRNKSPVREGSAERRAKIEQWNREREQAEATNKNDNSHSDNGNNNNDFEQDDQQYYNPQ 326 Query: 31 ----D*QPPAQQGG 2 D Q Q GG Sbjct: 327 HQEEDQQQQQQHGG 340