BLASTX nr result
ID: Coptis23_contig00004726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00004726 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537349.1| PREDICTED: uncharacterized protein LOC100818... 63 2e-08 >ref|XP_003537349.1| PREDICTED: uncharacterized protein LOC100818910 [Glycine max] Length = 50 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -2 Query: 194 MEPPPSQEF---GRNIQAQEDEQDKIINECCSCFYNCLENLFDFL 69 MEPPPSQ G QA +D QDK+INECCSC Y+C + LFDFL Sbjct: 1 MEPPPSQSIEISGHGYQAGDDTQDKVINECCSCCYDCTQGLFDFL 45