BLASTX nr result
ID: Coptis23_contig00004352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00004352 (634 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulga... 49 1e-06 ref|XP_002516137.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1389 Score = 48.5 bits (114), Expect(2) = 1e-06 Identities = 22/55 (40%), Positives = 32/55 (58%) Frame = -3 Query: 632 CSKKNMGGVGFKQSLYQNKALIAKLCWKLMTESYLLWVKIIKDKYF*HVSFLQAK 468 C K++GGVGF+++ N AL KL WK+M +WVK++ KY + L K Sbjct: 861 CQPKSVGGVGFRKAEVTNIALQMKLLWKIMVSKDNIWVKLVTQKYLKEQNLLVCK 915 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 388 ITDGQNIDIWDDNWIPFPPFKKPVDTPFL 302 I DGQ+I W DNWI F+ P+++ ++ Sbjct: 942 IGDGQDISFWTDNWI----FQYPLNSKYV 966 >ref|XP_002516137.1| conserved hypothetical protein [Ricinus communis] gi|223544623|gb|EEF46139.1| conserved hypothetical protein [Ricinus communis] Length = 310 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/53 (52%), Positives = 33/53 (62%) Frame = -3 Query: 623 KNMGGVGFKQSLYQNKALIAKLCWKLMTESYLLWVKIIKDKYF*HVSFLQAKK 465 K +GG+GFK N+A +AK WKL+ E LW KIIK YF H SF AKK Sbjct: 161 KEIGGMGFKDIEDFNRANLAKQSWKLINEGDRLWAKIIKGLYFPHTSFWNAKK 213