BLASTX nr result
ID: Coptis23_contig00004253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00004253 (885 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321224.1| predicted protein [Populus trichocarpa] gi|2... 114 3e-23 ref|XP_002863218.1| hypothetical protein ARALYDRAFT_333056 [Arab... 94 6e-22 emb|CAB40994.1| auxilin-like protein [Arabidopsis thaliana] gi|7... 90 1e-20 emb|CBI21587.3| unnamed protein product [Vitis vinifera] 97 4e-18 ref|XP_002275766.1| PREDICTED: auxilin-related protein 2-like [V... 97 4e-18 >ref|XP_002321224.1| predicted protein [Populus trichocarpa] gi|222861997|gb|EEE99539.1| predicted protein [Populus trichocarpa] Length = 941 Score = 114 bits (285), Expect = 3e-23 Identities = 69/136 (50%), Positives = 81/136 (59%) Frame = +1 Query: 88 EVLRHLENSRTLRGKLKKDEERDWIATNVHRSAQSVEISFSLFVCVYDYLYLSSYKCRKP 267 EVL HLE+S+ L+GKLKK E+ DW AT RS V ++D + L+ Sbjct: 775 EVLDHLESSKMLKGKLKKGEKPDWNATRGLRSGLYV---------LHDMILLT------- 818 Query: 268 IQVH*LVSY*ILLTSFLWSLCPQAKALAEKNERDRQTQRDQAERHRFAETLDVEIKRWSA 447 AKALAEKN+RD Q QRDQAERHR AETLDVEIKRW+A Sbjct: 819 -----------------------AKALAEKNQRDLQAQRDQAERHRIAETLDVEIKRWAA 855 Query: 448 GKQGNLRALLSTLQYI 495 GK+GNLRALLSTLQY+ Sbjct: 856 GKEGNLRALLSTLQYV 871 >ref|XP_002863218.1| hypothetical protein ARALYDRAFT_333056 [Arabidopsis lyrata subsp. lyrata] gi|297309052|gb|EFH39477.1| hypothetical protein ARALYDRAFT_333056 [Arabidopsis lyrata subsp. lyrata] Length = 920 Score = 94.4 bits (233), Expect(2) = 6e-22 Identities = 59/134 (44%), Positives = 72/134 (53%) Frame = +1 Query: 94 LRHLENSRTLRGKLKKDEERDWIATNVHRSAQSVEISFSLFVCVYDYLYLSSYKCRKPIQ 273 L +L + L KLK+D+ W AT HRS + +++ Sbjct: 752 LPNLVGFKMLMEKLKRDDVPGWNATRGHRSGLFASMFYNM-------------------- 791 Query: 274 VH*LVSY*ILLTSFLWSLCPQAKALAEKNERDRQTQRDQAERHRFAETLDVEIKRWSAGK 453 SFL QAKALAEKNERD Q QR+QAE+ R ETLDVEI+RW AGK Sbjct: 792 -----------NSFL----NQAKALAEKNERDLQVQREQAEKDRIGETLDVEIRRWGAGK 836 Query: 454 QGNLRALLSTLQYI 495 +GNLRALLSTLQY+ Sbjct: 837 EGNLRALLSTLQYV 850 Score = 36.6 bits (83), Expect(2) = 6e-22 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = +3 Query: 39 KASSTTNIVDDLTSIFGGASSS 104 KASS TNIVDDL+SIFGG++ S Sbjct: 729 KASSVTNIVDDLSSIFGGSAIS 750 >emb|CAB40994.1| auxilin-like protein [Arabidopsis thaliana] gi|7267978|emb|CAB78319.1| auxilin-like protein [Arabidopsis thaliana] Length = 909 Score = 90.1 bits (222), Expect(2) = 1e-20 Identities = 57/134 (42%), Positives = 70/134 (52%) Frame = +1 Query: 94 LRHLENSRTLRGKLKKDEERDWIATNVHRSAQSVEISFSLFVCVYDYLYLSSYKCRKPIQ 273 L +L + L KLK+D+ W T HRS + +++ Sbjct: 741 LPNLVGFKMLMEKLKRDDVPGWNVTRGHRSGLFASMFYNM-------------------- 780 Query: 274 VH*LVSY*ILLTSFLWSLCPQAKALAEKNERDRQTQRDQAERHRFAETLDVEIKRWSAGK 453 SFL QAKALAEKNERD Q QR+QAE+ R TLDVEI+RW AGK Sbjct: 781 -----------NSFL----NQAKALAEKNERDLQVQREQAEKDRIGGTLDVEIRRWGAGK 825 Query: 454 QGNLRALLSTLQYI 495 +GNLRALLSTLQY+ Sbjct: 826 EGNLRALLSTLQYV 839 Score = 36.6 bits (83), Expect(2) = 1e-20 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = +3 Query: 39 KASSTTNIVDDLTSIFGGASSS 104 KASS TNIVDDL+SIFGG++ S Sbjct: 718 KASSATNIVDDLSSIFGGSAIS 739 >emb|CBI21587.3| unnamed protein product [Vitis vinifera] Length = 217 Score = 97.4 bits (241), Expect = 4e-18 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +1 Query: 337 AKALAEKNERDRQTQRDQAERHRFAETLDVEIKRWSAGKQGNLRALLSTLQYI 495 AKALAEKN+RD Q QRDQAERHR AETLDVEIKRWSAGK+GNLRALLSTLQY+ Sbjct: 95 AKALAEKNQRDLQAQRDQAERHRIAETLDVEIKRWSAGKEGNLRALLSTLQYV 147 Score = 89.0 bits (219), Expect = 1e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 39 KASSTTNIVDDLTSIFGGASSSGEFQDVEGETEERRRARLDRHQRTQERA 188 KASSTTNIVDDL+SIFG A SSG+FQDVEGE+E+RRRARL+RHQRTQERA Sbjct: 45 KASSTTNIVDDLSSIFGAAPSSGDFQDVEGESEDRRRARLERHQRTQERA 94 >ref|XP_002275766.1| PREDICTED: auxilin-related protein 2-like [Vitis vinifera] Length = 949 Score = 97.4 bits (241), Expect = 4e-18 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +1 Query: 337 AKALAEKNERDRQTQRDQAERHRFAETLDVEIKRWSAGKQGNLRALLSTLQYI 495 AKALAEKN+RD Q QRDQAERHR AETLDVEIKRWSAGK+GNLRALLSTLQY+ Sbjct: 827 AKALAEKNQRDLQAQRDQAERHRIAETLDVEIKRWSAGKEGNLRALLSTLQYV 879 Score = 89.0 bits (219), Expect = 1e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 39 KASSTTNIVDDLTSIFGGASSSGEFQDVEGETEERRRARLDRHQRTQERA 188 KASSTTNIVDDL+SIFG A SSG+FQDVEGE+E+RRRARL+RHQRTQERA Sbjct: 777 KASSTTNIVDDLSSIFGAAPSSGDFQDVEGESEDRRRARLERHQRTQERA 826