BLASTX nr result
ID: Coptis23_contig00004045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00004045 (860 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614463.1| 52 kDa repressor of the inhibitor of the pro... 86 1e-14 gb|EAY83186.1| hypothetical protein OsI_38395 [Oryza sativa Indi... 85 2e-14 ref|XP_003602139.1| 52 kDa repressor of the inhibitor of the pro... 84 3e-14 gb|EAY76396.1| hypothetical protein OsI_04325 [Oryza sativa Indi... 84 4e-14 ref|XP_003598405.1| 52 kDa repressor of the inhibitor of the pro... 84 5e-14 >ref|XP_003614463.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355515798|gb|AES97421.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 796 Score = 85.9 bits (211), Expect = 1e-14 Identities = 50/112 (44%), Positives = 68/112 (60%), Gaps = 3/112 (2%) Frame = +2 Query: 182 PSQV-QVVEIEQIESSP-QAQRVSVEEVDSTSLFERDPGKRTPIYNYPVNQQDDVRQDFL 355 P QV + IE+ ES P + RV ++++++ ERDPGKR PIY YP NQ+D +R+ +L Sbjct: 29 PEQVHENPRIEENESRPSKINRVDPDDIENS--LERDPGKRIPIYQYPPNQKDAIRRAYL 86 Query: 356 GKGRWLLELSEKEYPSTIFGKQTRQFNSSWFTLF-PWLEYSLHMDRAYCFPC 508 G + L + YP + GK R+F SWF+LF WLEYS D AYC C Sbjct: 87 KWGPYQSNL--ENYPMSGIGKAQRRFQHSWFSLFSSWLEYSPSEDAAYCLQC 136 >gb|EAY83186.1| hypothetical protein OsI_38395 [Oryza sativa Indica Group] Length = 809 Score = 85.1 bits (209), Expect = 2e-14 Identities = 48/108 (44%), Positives = 61/108 (56%), Gaps = 5/108 (4%) Frame = +2 Query: 200 VEIEQ-----IESSPQAQRVSVEEVDSTSLFERDPGKRTPIYNYPVNQQDDVRQDFLGKG 364 VEIE IE + Q + +EV T+ FERDPGKR I P +QQD+ R+ ++ +G Sbjct: 22 VEIENPSPTNIEVADQENLQAEQEVIVTTAFERDPGKRVQISALPADQQDEARRFYISEG 81 Query: 365 RWLLELSEKEYPSTIFGKQTRQFNSSWFTLFPWLEYSLHMDRAYCFPC 508 + L E YP R+F S+WF F WLEYS H DRAYC PC Sbjct: 82 PYQFILDE--YPLND-ASHARRFQSNWFKQFSWLEYSPHTDRAYCLPC 126 >ref|XP_003602139.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355491187|gb|AES72390.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 785 Score = 84.3 bits (207), Expect = 3e-14 Identities = 46/103 (44%), Positives = 64/103 (62%), Gaps = 2/103 (1%) Frame = +2 Query: 206 IEQIESSP-QAQRVSVEEVDSTSLFERDPGKRTPIYNYPVNQQDDVRQDFLGKGRWLLEL 382 +E+ ES P + RV ++++++ ERDPGKR PIY YP NQ+D +R+ +L G + L Sbjct: 1 MEENESCPSKINRVDPDDIENS--LERDPGKRIPIYQYPPNQKDAIRRAYLKWGPYQSNL 58 Query: 383 SEKEYPSTIFGKQTRQFNSSWFTLF-PWLEYSLHMDRAYCFPC 508 + YP + GK R+F SWF+LF WLEYS D AYC C Sbjct: 59 --ENYPMSGIGKAQRRFQHSWFSLFSSWLEYSPSEDAAYCLQC 99 >gb|EAY76396.1| hypothetical protein OsI_04325 [Oryza sativa Indica Group] Length = 601 Score = 84.0 bits (206), Expect = 4e-14 Identities = 45/109 (41%), Positives = 61/109 (55%) Frame = +2 Query: 182 PSQVQVVEIEQIESSPQAQRVSVEEVDSTSLFERDPGKRTPIYNYPVNQQDDVRQDFLGK 361 P+ V+V + E ++ +EV T+ FERDPGKR I P +QQD+ R+ ++ + Sbjct: 29 PTNVEVADQENLQVE--------QEVIVTTAFERDPGKRVQISALPADQQDEARRFYISE 80 Query: 362 GRWLLELSEKEYPSTIFGKQTRQFNSSWFTLFPWLEYSLHMDRAYCFPC 508 G + L E YP R+F S+WF F WLEYS H DRAYC PC Sbjct: 81 GPYQFILDE--YPLND-ASHARRFQSNWFKQFSWLEYSPHTDRAYCLPC 126 >ref|XP_003598405.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|358348356|ref|XP_003638213.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355487453|gb|AES68656.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355504148|gb|AES85351.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 822 Score = 83.6 bits (205), Expect = 5e-14 Identities = 49/112 (43%), Positives = 68/112 (60%), Gaps = 3/112 (2%) Frame = +2 Query: 182 PSQV-QVVEIEQIESSP-QAQRVSVEEVDSTSLFERDPGKRTPIYNYPVNQQDDVRQDFL 355 P QV + IE+ ES P + RV ++++++ ERDPGK PIY YP NQ+D +R+ +L Sbjct: 29 PEQVHENPRIEENESRPSKINRVDPDDIENS--LERDPGKCIPIYQYPPNQKDAIRRAYL 86 Query: 356 GKGRWLLELSEKEYPSTIFGKQTRQFNSSWFTLF-PWLEYSLHMDRAYCFPC 508 G + L + YP + GK R+F +SWF+LF WLEYS D AYC C Sbjct: 87 KWGPYQSNL--ENYPMSGIGKAQRRFQNSWFSLFSSWLEYSPSEDAAYCLQC 136