BLASTX nr result
ID: Coptis23_contig00003988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00003988 (726 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135261.1| PREDICTED: alpha-glucan water dikinase, chlo... 45 7e-06 ref|XP_004164397.1| PREDICTED: LOW QUALITY PROTEIN: alpha-glucan... 45 7e-06 >ref|XP_004135261.1| PREDICTED: alpha-glucan water dikinase, chloroplastic-like [Cucumis sativus] Length = 1482 Score = 44.7 bits (104), Expect(2) = 7e-06 Identities = 22/39 (56%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = +2 Query: 56 GYSSTDIPG---IMFFISLMLQNLCLSTVDNEDLIYCTK 163 GY + G IM+FI+L+L+NL LS+ DNEDLIYC K Sbjct: 891 GYEELNTAGPEKIMYFITLVLENLALSSDDNEDLIYCLK 929 Score = 31.2 bits (69), Expect(2) = 7e-06 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = +3 Query: 3 LDLALDSAVRTTMERGLKDI 62 LD+ALDSAVRT +ERG +++ Sbjct: 876 LDIALDSAVRTAVERGYEEL 895 >ref|XP_004164397.1| PREDICTED: LOW QUALITY PROTEIN: alpha-glucan water dikinase, chloroplastic-like, partial [Cucumis sativus] Length = 1471 Score = 44.7 bits (104), Expect(2) = 7e-06 Identities = 22/39 (56%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = +2 Query: 56 GYSSTDIPG---IMFFISLMLQNLCLSTVDNEDLIYCTK 163 GY + G IM+FI+L+L+NL LS+ DNEDLIYC K Sbjct: 890 GYEELNTAGPEKIMYFITLVLENLALSSDDNEDLIYCLK 928 Score = 31.2 bits (69), Expect(2) = 7e-06 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = +3 Query: 3 LDLALDSAVRTTMERGLKDI 62 LD+ALDSAVRT +ERG +++ Sbjct: 875 LDIALDSAVRTAVERGYEEL 894