BLASTX nr result
ID: Coptis23_contig00003422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00003422 (825 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002456545.1| hypothetical protein SORBIDRAFT_03g038140 [S... 44 8e-08 dbj|BAK05065.1| predicted protein [Hordeum vulgare subsp. vulgare] 49 1e-07 gb|ACE80735.1| pentatricopeptide repeat protein [Diplophyllum al... 44 1e-07 ref|XP_003580399.1| PREDICTED: pentatricopeptide repeat-containi... 45 3e-07 gb|EEC77866.1| hypothetical protein OsI_17132 [Oryza sativa Indi... 47 3e-07 >ref|XP_002456545.1| hypothetical protein SORBIDRAFT_03g038140 [Sorghum bicolor] gi|241928520|gb|EES01665.1| hypothetical protein SORBIDRAFT_03g038140 [Sorghum bicolor] Length = 640 Score = 43.9 bits (102), Expect(2) = 8e-08 Identities = 19/49 (38%), Positives = 33/49 (67%) Frame = -3 Query: 646 GQQAIVATVKRLIKDRGVKTKPGCCWIEVKNKIHVFETAGCAHVPELRR 500 GQ VA V+ ++++RG+K +PGC ++E K ++H+F +H P+ RR Sbjct: 483 GQLDCVARVRAMMRERGLKKEPGCSYVEHKGRVHLFMADDHSH-PQARR 530 Score = 38.9 bits (89), Expect(2) = 8e-08 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 2/56 (3%) Frame = -2 Query: 521 SCARTEAGLERE-LSIAFGM-STQDGEPIRVVRILRTCEDSHNSIKFISASLNSLF 360 + A+ G+ E L++AFG+ +T+ G I V++ LR C D H+ +K +SA+ N F Sbjct: 563 AAAQPLVGIHSEKLAVAFGLLNTEAGSEIVVIKNLRVCGDCHSFLKVVSATTNRAF 618 >dbj|BAK05065.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 889 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 19/43 (44%), Positives = 30/43 (69%) Frame = -3 Query: 646 GQQAIVATVKRLIKDRGVKTKPGCCWIEVKNKIHVFETAGCAH 518 G+ A V++L++D+G+K PG W+EVKNK+HVF+ +H Sbjct: 745 GKSVDSAQVRKLMRDKGIKKNPGYSWMEVKNKVHVFKAEDVSH 787 Score = 32.7 bits (73), Expect(2) = 1e-07 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -2 Query: 512 RTEAGLERELSIAFG-MSTQDGEPIRVVRILRTCEDSHNSIKFIS 381 R+E +L++AFG M+ PI +++ LR C D H IK IS Sbjct: 816 RSEIHHSEKLAVAFGIMNLPAWMPIHIMKNLRICGDCHTVIKLIS 860 >gb|ACE80735.1| pentatricopeptide repeat protein [Diplophyllum albicans] Length = 152 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 21/41 (51%), Positives = 30/41 (73%) Frame = -3 Query: 631 VATVKRLIKDRGVKTKPGCCWIEVKNKIHVFETAGCAHVPE 509 V+ V++L+++RGV+ +PG WIEV NKIH F AG + PE Sbjct: 9 VSLVRKLMEERGVRKEPGRSWIEVDNKIHEF-VAGDTYHPE 48 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 22/47 (46%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -2 Query: 518 CARTEAGLERELSIAFG-MSTQDGEPIRVVRILRTCEDSHNSIKFIS 381 CA +E +L+IA+G M GEPIRV + LR C D H + K IS Sbjct: 89 CAHSE-----KLAIAYGLMRIPRGEPIRVTKDLRVCPDCHTATKLIS 130 >ref|XP_003580399.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Brachypodium distachyon] Length = 886 Score = 45.4 bits (106), Expect(2) = 3e-07 Identities = 16/37 (43%), Positives = 27/37 (72%) Frame = -3 Query: 628 ATVKRLIKDRGVKTKPGCCWIEVKNKIHVFETAGCAH 518 A V++L++D+G+K PG W+EV N++HVF+ +H Sbjct: 748 AQVRKLMRDKGIKKSPGYSWMEVNNRVHVFKAEDVSH 784 Score = 35.4 bits (80), Expect(2) = 3e-07 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -2 Query: 512 RTEAGLERELSIAFG-MSTQDGEPIRVVRILRTCEDSHNSIKFIS 381 R+E +L++AFG MS PI +++ LR C+D H IK IS Sbjct: 813 RSEIHHSEKLAVAFGIMSLPAWMPIHIMKNLRICDDCHTVIKLIS 857 >gb|EEC77866.1| hypothetical protein OsI_17132 [Oryza sativa Indica Group] Length = 865 Score = 46.6 bits (109), Expect(2) = 3e-07 Identities = 17/37 (45%), Positives = 28/37 (75%) Frame = -3 Query: 628 ATVKRLIKDRGVKTKPGCCWIEVKNKIHVFETAGCAH 518 A V++L++D+G+K PG W+EV+NK+HVF+ +H Sbjct: 727 AQVRKLMRDKGIKKNPGYSWMEVENKVHVFKADDVSH 763 Score = 34.3 bits (77), Expect(2) = 3e-07 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -2 Query: 512 RTEAGLERELSIAFG-MSTQDGEPIRVVRILRTCEDSHNSIKFISA 378 R+E +L++AFG MS PI +++ LR C D H IK IS+ Sbjct: 792 RSEIHHSEKLAVAFGIMSLPAWMPIHIMKNLRICGDCHTVIKLISS 837