BLASTX nr result
ID: Coptis23_contig00003179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00003179 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP54302.1| ARF domain class transcription factor [Pyrus x br... 57 1e-06 ref|XP_002285483.2| PREDICTED: auxin-responsive protein IAA13-li... 57 1e-06 gb|ADL36583.1| ARF domain class transcription factor [Malus x do... 57 1e-06 emb|CBI23724.3| unnamed protein product [Vitis vinifera] 57 1e-06 ref|XP_002285481.1| PREDICTED: auxin-responsive protein IAA13-li... 57 1e-06 >gb|AFP54302.1| ARF domain class transcription factor [Pyrus x bretschneideri] Length = 306 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 453 MFLNTVKRLRIMRTSEAKGLAPRIHGSSDRQRNKPI 346 MFL +VKRLRIMRTSEA GLAPR S+RQRNKPI Sbjct: 271 MFLGSVKRLRIMRTSEANGLAPRFQERSERQRNKPI 306 >ref|XP_002285483.2| PREDICTED: auxin-responsive protein IAA13-like isoform 2 [Vitis vinifera] Length = 321 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 453 MFLNTVKRLRIMRTSEAKGLAPRIHGSSDRQRNKPI 346 MFL+TVKRLRIMRTSEA GLAPR S+RQR+KPI Sbjct: 286 MFLSTVKRLRIMRTSEANGLAPRFQERSERQRSKPI 321 >gb|ADL36583.1| ARF domain class transcription factor [Malus x domestica] Length = 306 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 453 MFLNTVKRLRIMRTSEAKGLAPRIHGSSDRQRNKPI 346 MFL +VKRLRIMRTSEA GLAPR S+RQRNKPI Sbjct: 271 MFLGSVKRLRIMRTSEANGLAPRFQERSERQRNKPI 306 >emb|CBI23724.3| unnamed protein product [Vitis vinifera] Length = 283 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 453 MFLNTVKRLRIMRTSEAKGLAPRIHGSSDRQRNKPI 346 MFL+TVKRLRIMRTSEA GLAPR S+RQR+KPI Sbjct: 248 MFLSTVKRLRIMRTSEANGLAPRFQERSERQRSKPI 283 >ref|XP_002285481.1| PREDICTED: auxin-responsive protein IAA13-like isoform 1 [Vitis vinifera] Length = 314 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 453 MFLNTVKRLRIMRTSEAKGLAPRIHGSSDRQRNKPI 346 MFL+TVKRLRIMRTSEA GLAPR S+RQR+KPI Sbjct: 279 MFLSTVKRLRIMRTSEANGLAPRFQERSERQRSKPI 314