BLASTX nr result
ID: Coptis23_contig00002681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00002681 (636 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621690.1| Cytochrome c biogenesis protein ccsA [Medica... 42 8e-07 >ref|XP_003621690.1| Cytochrome c biogenesis protein ccsA [Medicago truncatula] gi|355496705|gb|AES77908.1| Cytochrome c biogenesis protein ccsA [Medicago truncatula] Length = 666 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 16/39 (41%), Positives = 26/39 (66%) Frame = -1 Query: 540 IHPKTSALAWKLMNNCSATEEKVQRRGIALVSRCCLCMQ 424 I P S + W+L++N T+E +++RG +VS CC CM+ Sbjct: 45 IPPSRSFITWRLLHNKLPTDENLRKRGCLIVSICCFCMK 83 Score = 36.6 bits (83), Expect(2) = 8e-07 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 440 VVCVCKKKSESLHHIFWSCPFAKQLWRWI 354 + C C K +ES HIF+ C +LW W+ Sbjct: 77 ICCFCMKSAESSQHIFFECHVTSRLWDWL 105