BLASTX nr result
ID: Coptis23_contig00001944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00001944 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328962.1| predicted protein [Populus trichocarpa] gi|1... 55 6e-06 >ref|XP_002328962.1| predicted protein [Populus trichocarpa] gi|118482664|gb|ABK93251.1| unknown [Populus trichocarpa] gi|222839196|gb|EEE77547.1| predicted protein [Populus trichocarpa] Length = 209 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 6/69 (8%) Frame = -2 Query: 189 NIPLTPIIKS------TVPSHICMASYQTVPASDRLISIISYFIPFLSGLSYGYHLFSYF 28 N PLTP +K + S + SY PA+DRL+S +SY +PF + L YG LF+ + Sbjct: 28 NPPLTPFLKFPPKTRLSQKSTVTRMSYNPTPATDRLVSAVSYTLPFFNSLQYGRFLFTTY 87 Query: 27 PTLEFIFNP 1 P+L + +P Sbjct: 88 PSLALLVDP 96