BLASTX nr result
ID: Coptis23_contig00001897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00001897 (644 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527695.1| glutaredoxin-1, grx1, putative [Ricinus comm... 167 2e-39 ref|XP_002325236.1| glutaredoxin C4 [Populus trichocarpa] gi|118... 163 2e-38 gb|AAL90750.1| glutaredoxin [Populus tremula x Populus tremuloides] 162 7e-38 emb|CBI17872.3| unnamed protein product [Vitis vinifera] 160 2e-37 ref|XP_002266525.1| PREDICTED: glutaredoxin-C4-like [Vitis vinif... 160 2e-37 >ref|XP_002527695.1| glutaredoxin-1, grx1, putative [Ricinus communis] gi|223532926|gb|EEF34694.1| glutaredoxin-1, grx1, putative [Ricinus communis] Length = 140 Score = 167 bits (423), Expect = 2e-39 Identities = 76/95 (80%), Positives = 91/95 (95%) Frame = +1 Query: 1 VSSHHIVIFSKSYCPYCRRAKAVFKELNQSPHIIELDERDDGWDLQDALSEVVGRRTVPQ 180 +SSH IVIFSKSYCPYC+RAKAVFK+LNQ PH++ELDERDDG ++QDALS++VGRRTVPQ Sbjct: 46 ISSHKIVIFSKSYCPYCKRAKAVFKQLNQIPHVVELDERDDGQNIQDALSKIVGRRTVPQ 105 Query: 181 VFVNGKHIGGSDDTVEAFESGKLAELLGVAKKDDL 285 VF++GKHIGGSDDTVEA+ESG+LA+LLG+A KDDL Sbjct: 106 VFIDGKHIGGSDDTVEAYESGELADLLGIAGKDDL 140 >ref|XP_002325236.1| glutaredoxin C4 [Populus trichocarpa] gi|118483557|gb|ABK93676.1| unknown [Populus trichocarpa] gi|118488597|gb|ABK96111.1| unknown [Populus trichocarpa] gi|222866670|gb|EEF03801.1| glutaredoxin C4 [Populus trichocarpa] Length = 136 Score = 163 bits (413), Expect = 2e-38 Identities = 75/97 (77%), Positives = 92/97 (94%), Gaps = 2/97 (2%) Frame = +1 Query: 1 VSSHHIVIFSKSYCPYCRRAKAVFKELNQSPHIIELDERDDGWDLQDALSEVVGRRTVPQ 180 +SSH IVIFSKSYCPYC++AK VFKELNQ+PH++ELD+R+DG D+QDA+SE+VGRRTVPQ Sbjct: 40 ISSHQIVIFSKSYCPYCKKAKGVFKELNQTPHVVELDQREDGHDIQDAMSEIVGRRTVPQ 99 Query: 181 VFVNGKHIGGSDDTVEAFESGKLAELLGVA--KKDDL 285 VF++GKHIGGSDDTVEA+ESG+LA+LLGVA +KDDL Sbjct: 100 VFIDGKHIGGSDDTVEAYESGELAKLLGVASEQKDDL 136 >gb|AAL90750.1| glutaredoxin [Populus tremula x Populus tremuloides] Length = 139 Score = 162 bits (409), Expect = 7e-38 Identities = 74/96 (77%), Positives = 91/96 (94%), Gaps = 2/96 (2%) Frame = +1 Query: 1 VSSHHIVIFSKSYCPYCRRAKAVFKELNQSPHIIELDERDDGWDLQDALSEVVGRRTVPQ 180 +SSH IVIFSKSYCPYC++AK VFKELNQ+PH++ELD+R+DG D+QDA+SE+VGRRTVPQ Sbjct: 40 ISSHQIVIFSKSYCPYCKKAKGVFKELNQTPHVVELDQREDGHDIQDAMSEIVGRRTVPQ 99 Query: 181 VFVNGKHIGGSDDTVEAFESGKLAELLGVA--KKDD 282 VF++GKHIGGSDDTVEA+ESG+LA+LLGVA +KDD Sbjct: 100 VFIDGKHIGGSDDTVEAYESGELAKLLGVASEQKDD 135 >emb|CBI17872.3| unnamed protein product [Vitis vinifera] Length = 136 Score = 160 bits (405), Expect = 2e-37 Identities = 71/93 (76%), Positives = 88/93 (94%) Frame = +1 Query: 1 VSSHHIVIFSKSYCPYCRRAKAVFKELNQSPHIIELDERDDGWDLQDALSEVVGRRTVPQ 180 +SSH I IFSKSYCPYC+RAKAVFKELNQ P+++ELD+R+DGW++QDALS +VGRRTVPQ Sbjct: 40 ISSHKIAIFSKSYCPYCKRAKAVFKELNQVPYVVELDQREDGWNIQDALSGMVGRRTVPQ 99 Query: 181 VFVNGKHIGGSDDTVEAFESGKLAELLGVAKKD 279 VF+NGKHIGGSDDTVEA++SG LA+LLG+A++D Sbjct: 100 VFINGKHIGGSDDTVEAYQSGDLAKLLGIAEED 132 >ref|XP_002266525.1| PREDICTED: glutaredoxin-C4-like [Vitis vinifera] Length = 140 Score = 160 bits (405), Expect = 2e-37 Identities = 71/93 (76%), Positives = 88/93 (94%) Frame = +1 Query: 1 VSSHHIVIFSKSYCPYCRRAKAVFKELNQSPHIIELDERDDGWDLQDALSEVVGRRTVPQ 180 +SSH I IFSKSYCPYC+RAKAVFKELNQ P+++ELD+R+DGW++QDALS +VGRRTVPQ Sbjct: 44 ISSHKIAIFSKSYCPYCKRAKAVFKELNQVPYVVELDQREDGWNIQDALSGMVGRRTVPQ 103 Query: 181 VFVNGKHIGGSDDTVEAFESGKLAELLGVAKKD 279 VF+NGKHIGGSDDTVEA++SG LA+LLG+A++D Sbjct: 104 VFINGKHIGGSDDTVEAYQSGDLAKLLGIAEED 136