BLASTX nr result
ID: Coptis23_contig00001559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00001559 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH59405.1| light harvesting protein 1 [Plantago major] 142 3e-32 pdb|1VCR|A Chain A, An Icosahedral Assembly Of Light-Harvesting ... 142 4e-32 gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisu... 142 4e-32 pdb|2BHW|A Chain A, Pea Light-Harvesting Complex Ii At 2.5 Angst... 142 4e-32 gb|AAW31511.1| light-harvesting chlorophyll-a/b binding protein ... 142 4e-32 >emb|CAH59405.1| light harvesting protein 1 [Plantago major] Length = 229 Score = 142 bits (358), Expect = 3e-32 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -3 Query: 197 SSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW 18 SSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRW Sbjct: 9 SSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRW 68 Query: 17 AMLGA 3 AMLGA Sbjct: 69 AMLGA 73 >pdb|1VCR|A Chain A, An Icosahedral Assembly Of Light-Harvesting Chlorophyll AB Protein Complex From Pea Thylakoid Membranes Length = 232 Score = 142 bits (357), Expect = 4e-32 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = -3 Query: 197 SSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW 18 S SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW Sbjct: 12 SGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW 71 Query: 17 AMLGA 3 AMLGA Sbjct: 72 AMLGA 76 >gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisum sativum] Length = 266 Score = 142 bits (357), Expect = 4e-32 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = -3 Query: 197 SSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW 18 S SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW Sbjct: 46 SGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW 105 Query: 17 AMLGA 3 AMLGA Sbjct: 106 AMLGA 110 >pdb|2BHW|A Chain A, Pea Light-Harvesting Complex Ii At 2.5 Angstrom Resolution gi|109157230|pdb|2BHW|B Chain B, Pea Light-Harvesting Complex Ii At 2.5 Angstrom Resolution gi|109157231|pdb|2BHW|C Chain C, Pea Light-Harvesting Complex Ii At 2.5 Angstrom Resolution Length = 232 Score = 142 bits (357), Expect = 4e-32 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = -3 Query: 197 SSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW 18 S SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW Sbjct: 12 SGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW 71 Query: 17 AMLGA 3 AMLGA Sbjct: 72 AMLGA 76 >gb|AAW31511.1| light-harvesting chlorophyll-a/b binding protein Lhcb1 [Pisum sativum] Length = 266 Score = 142 bits (357), Expect = 4e-32 Identities = 64/65 (98%), Positives = 64/65 (98%) Frame = -3 Query: 197 SSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW 18 S SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW Sbjct: 46 SGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRW 105 Query: 17 AMLGA 3 AMLGA Sbjct: 106 AMLGA 110