BLASTX nr result
ID: Coptis23_contig00000666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00000666 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526678.1| breast cancer type 2 susceptibility protein ... 56 3e-06 >ref|XP_002526678.1| breast cancer type 2 susceptibility protein brca2, putative [Ricinus communis] gi|223533978|gb|EEF35700.1| breast cancer type 2 susceptibility protein brca2, putative [Ricinus communis] Length = 1156 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 104 MDAILDVPLSKQLVAGKLFVGQKLRIWRAVVC 199 +DAILDVPLSKQL +GKLFVGQKLRIW A +C Sbjct: 653 VDAILDVPLSKQLASGKLFVGQKLRIWGARLC 684