BLASTX nr result
ID: Coptis23_contig00000337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00000337 (553 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514207.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 >ref|XP_002514207.1| conserved hypothetical protein [Ricinus communis] gi|223546663|gb|EEF48161.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 59.3 bits (142), Expect = 4e-07 Identities = 32/69 (46%), Positives = 41/69 (59%) Frame = -1 Query: 391 MKDSGKSGKVNGKYGQQDGRKDRRSAXXXXXXXXXXXXXXKFTWAGIGFSHVEIGLEKKD 212 MK++GKS K + + D R+DR+SA KFTWAG G+S EIG + KD Sbjct: 1 MKNTGKSSKSSTANSKSDARRDRKSATGMSGSPKKGGHGGKFTWAGDGYSPAEIGYQ-KD 59 Query: 211 ILDNKDPNF 185 +LD KDPNF Sbjct: 60 VLDAKDPNF 68