BLASTX nr result
ID: Coptis23_contig00000175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00000175 (1056 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512408.1| Potassium transporter, putative [Ricinus com... 70 7e-10 ref|NP_001234372.1| HAK5 [Solanum lycopersicum] gi|94483077|gb|A... 68 4e-09 ref|XP_002332061.1| predicted protein [Populus trichocarpa] gi|2... 66 2e-08 ref|XP_004152328.1| PREDICTED: potassium transporter 5-like [Cuc... 65 2e-08 ref|XP_002512690.1| Potassium transporter, putative [Ricinus com... 65 3e-08 >ref|XP_002512408.1| Potassium transporter, putative [Ricinus communis] gi|223548369|gb|EEF49860.1| Potassium transporter, putative [Ricinus communis] Length = 756 Score = 70.5 bits (171), Expect = 7e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -1 Query: 939 ISFSCIVFPSLICAYSGQVAYLTKFPDHVADTFYKSIPGQL 817 ISFS +VFP+L+CAY+GQ AYLTKFP+ V+DTFYKSIPG L Sbjct: 328 ISFSGVVFPALLCAYAGQAAYLTKFPEDVSDTFYKSIPGPL 368 >ref|NP_001234372.1| HAK5 [Solanum lycopersicum] gi|94483077|gb|ABF22603.1| HAK5 [Solanum lycopersicum] Length = 786 Score = 67.8 bits (164), Expect = 4e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 939 ISFSCIVFPSLICAYSGQVAYLTKFPDHVADTFYKSIPGQL 817 ISFSC+VFP+L+ AYSGQ AYLTKFP++VA+TFY IPG L Sbjct: 326 ISFSCLVFPALLSAYSGQAAYLTKFPENVANTFYDCIPGPL 366 >ref|XP_002332061.1| predicted protein [Populus trichocarpa] gi|222831947|gb|EEE70424.1| predicted protein [Populus trichocarpa] Length = 780 Score = 65.9 bits (159), Expect = 2e-08 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -1 Query: 939 ISFSCIVFPSLICAYSGQVAYLTKFPDHVADTFYKSIPGQL 817 ISFS IVFP+LI AYSGQ AYLTKF D V+DTFYKSIP L Sbjct: 322 ISFSSIVFPALIAAYSGQAAYLTKFKDDVSDTFYKSIPDPL 362 >ref|XP_004152328.1| PREDICTED: potassium transporter 5-like [Cucumis sativus] gi|449517028|ref|XP_004165548.1| PREDICTED: potassium transporter 5-like [Cucumis sativus] Length = 787 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -1 Query: 939 ISFSCIVFPSLICAYSGQVAYLTKFPDHVADTFYKSIPGQL 817 ISFS IVFP+L+ AYSGQ AYL KFPDHVA TFY SIP L Sbjct: 323 ISFSSIVFPALLAAYSGQAAYLRKFPDHVAHTFYDSIPDPL 363 >ref|XP_002512690.1| Potassium transporter, putative [Ricinus communis] gi|223548651|gb|EEF50142.1| Potassium transporter, putative [Ricinus communis] Length = 489 Score = 65.1 bits (157), Expect = 3e-08 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -1 Query: 939 ISFSCIVFPSLICAYSGQVAYLTKFPDHVADTFYKSIPGQL 817 ISFS IVFP+L+ AY+GQ AYLTKFP+ V+DTFYKSIP L Sbjct: 330 ISFSTIVFPALLSAYAGQAAYLTKFPEDVSDTFYKSIPDPL 370