BLASTX nr result
ID: Coptis23_contig00000009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00000009 (475 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW90621.1| protease inhibitor-related protein [Solanum tuber... 75 4e-12 gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuber... 75 4e-12 sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322... 75 4e-12 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium] 73 2e-11 dbj|BAH29762.1| defensin-like cystein-rich peptide [Torenia four... 72 5e-11 >gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum] Length = 78 Score = 75.5 bits (184), Expect = 4e-12 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 473 KFNGPCVRNSNCASICAGERFSGGKCEGFRRRCMCTKPC 357 +F GPC R+SNCAS+C ERFSGG C GFRRRC CTKPC Sbjct: 40 RFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC 78 >gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum] Length = 78 Score = 75.5 bits (184), Expect = 4e-12 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 473 KFNGPCVRNSNCASICAGERFSGGKCEGFRRRCMCTKPC 357 +F GPC R+SNCAS+C ERFSGG C GFRRRC CTKPC Sbjct: 40 RFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC 78 >sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable protease inhibitor P322; Flags: Precursor gi|21394|emb|CAA31577.1| unnamed protein product [Solanum tuberosum] Length = 74 Score = 75.5 bits (184), Expect = 4e-12 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 473 KFNGPCVRNSNCASICAGERFSGGKCEGFRRRCMCTKPC 357 +F GPC R+SNCAS+C ERFSGG C GFRRRC CTKPC Sbjct: 36 RFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC 74 >gb|ABO36643.1| defensin protein [Solanum pimpinellifolium] Length = 78 Score = 73.2 bits (178), Expect = 2e-11 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 473 KFNGPCVRNSNCASICAGERFSGGKCEGFRRRCMCTKPC 357 +F GPCV + NCAS+C ERFSGG C GFRRRC CTKPC Sbjct: 40 RFKGPCVSDKNCASVCETERFSGGNCRGFRRRCFCTKPC 78 >dbj|BAH29762.1| defensin-like cystein-rich peptide [Torenia fournieri] Length = 71 Score = 72.0 bits (175), Expect = 5e-11 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 473 KFNGPCVRNSNCASICAGERFSGGKCEGFRRRCMCTKPC 357 KF GPC +SNC S+C GE F+GG+CEGFRRRC C+KPC Sbjct: 33 KFKGPCFSDSNCQSVCEGEGFTGGECEGFRRRCFCSKPC 71