BLASTX nr result
ID: Coptis21_contig00041377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00041377 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535170.1| conserved hypothetical protein [Ricinus comm... 77 3e-14 >ref|XP_002535170.1| conserved hypothetical protein [Ricinus communis] gi|255598352|ref|XP_002536987.1| conserved hypothetical protein [Ricinus communis] gi|223517891|gb|EEF25396.1| conserved hypothetical protein [Ricinus communis] gi|223523842|gb|EEF27215.1| conserved hypothetical protein [Ricinus communis] Length = 122 Score = 76.6 bits (187), Expect(2) = 3e-14 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 257 DEWGILLVTVPIVGRTNAAGGVQNRPAEDGRVHVVEPRARE 135 +EWGILLVTVP+ RTNAAGGVQNRPAEDGRV+VVEPRARE Sbjct: 28 EEWGILLVTVPMFRRTNAAGGVQNRPAEDGRVNVVEPRARE 68 Score = 26.6 bits (57), Expect(2) = 3e-14 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 55 VSQRQQKGGGSG 20 VSQRQQKGGG G Sbjct: 72 VSQRQQKGGGDG 83