BLASTX nr result
ID: Coptis21_contig00041290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00041290 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150882.1| PREDICTED: chlorophyll a-b binding protein 4... 82 5e-14 ref|XP_002327136.1| light-harvesting complex I protein Lhca5 [Po... 82 5e-14 ref|XP_003528272.1| PREDICTED: chlorophyll a-b binding protein 7... 82 6e-14 ref|XP_002510221.1| chlorophyll A/B binding protein, putative [R... 82 6e-14 gb|AAD28768.1|AF134121_1 Lhca5 protein [Arabidopsis thaliana] 79 5e-13 >ref|XP_004150882.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like [Cucumis sativus] gi|449522610|ref|XP_004168319.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like [Cucumis sativus] Length = 259 Score = 82.0 bits (201), Expect = 5e-14 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 235 GRLAMVAMLGFFVQAYVTHAGPVDNLLTHLSDPWHRTLIQTLADSS 98 GRLAMVAMLG FVQAYVTH GP+DNL+ HLS+PWH+T+IQTL+ SS Sbjct: 213 GRLAMVAMLGIFVQAYVTHTGPIDNLVEHLSNPWHKTIIQTLSSSS 258 >ref|XP_002327136.1| light-harvesting complex I protein Lhca5 [Populus trichocarpa] gi|222835451|gb|EEE73886.1| light-harvesting complex I protein Lhca5 [Populus trichocarpa] Length = 266 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -3 Query: 235 GRLAMVAMLGFFVQAYVTHAGPVDNLLTHLSDPWHRTLIQTLADSSS 95 GRLAMVAM+G FVQA VTHAGP+DNL+ HLS+PWHRT+IQTLA+S S Sbjct: 220 GRLAMVAMVGIFVQAAVTHAGPIDNLIEHLSNPWHRTIIQTLANSGS 266 >ref|XP_003528272.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like [Glycine max] Length = 263 Score = 81.6 bits (200), Expect = 6e-14 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -3 Query: 235 GRLAMVAMLGFFVQAYVTHAGPVDNLLTHLSDPWHRTLIQTLADSSS 95 GRLAMVAMLG FVQA VTH GP+DNL+ HLS+PWH+T+IQTLA+SSS Sbjct: 217 GRLAMVAMLGIFVQASVTHVGPIDNLVEHLSNPWHKTIIQTLANSSS 263 >ref|XP_002510221.1| chlorophyll A/B binding protein, putative [Ricinus communis] gi|223550922|gb|EEF52408.1| chlorophyll A/B binding protein, putative [Ricinus communis] Length = 269 Score = 81.6 bits (200), Expect = 6e-14 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -3 Query: 235 GRLAMVAMLGFFVQAYVTHAGPVDNLLTHLSDPWHRTLIQTLADSSS 95 GRLAMVAMLG FVQA VTH GP+DNLL HLSDPWH+T+IQTL+ S+S Sbjct: 223 GRLAMVAMLGIFVQAAVTHTGPIDNLLEHLSDPWHKTIIQTLSHSTS 269 >gb|AAD28768.1|AF134121_1 Lhca5 protein [Arabidopsis thaliana] Length = 256 Score = 78.6 bits (192), Expect = 5e-13 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -3 Query: 235 GRLAMVAMLGFFVQAYVTHAGPVDNLLTHLSDPWHRTLIQTLADSSS 95 GRLAM+AMLGFFVQA VTH GP+DNL+ HLS+PWH+T+IQTL S+S Sbjct: 210 GRLAMMAMLGFFVQASVTHTGPIDNLVEHLSNPWHKTIIQTLFTSTS 256