BLASTX nr result
ID: Coptis21_contig00041270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00041270 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31112.3| unnamed protein product [Vitis vinifera] 91 1e-16 dbj|BAD83520.2| orfB protein (mitochondrion) [Nicotiana tabacum] 86 3e-15 ref|YP_005090498.1| ATPase subunit 8 (mitochondrion) [Lotus japo... 85 5e-15 ref|YP_005090447.1| ATPase subunit 8 (mitochondrion) [Millettia ... 85 5e-15 ref|XP_002335238.1| predicted protein [Populus trichocarpa] gi|2... 85 5e-15 >emb|CBI31112.3| unnamed protein product [Vitis vinifera] Length = 2099 Score = 90.5 bits (223), Expect = 1e-16 Identities = 41/50 (82%), Positives = 43/50 (86%) Frame = -2 Query: 152 CMEGKIDSKSIMPQLDKFTYFTQFFWLCLLFFTFYIAICNDGDGVLGISR 3 C+EG I S+S MPQLDKFTYFTQFFW CL FTFYI ICNDGDGVLGISR Sbjct: 1930 CLEGIIFSQSRMPQLDKFTYFTQFFWSCLFLFTFYIPICNDGDGVLGISR 1979 >dbj|BAD83520.2| orfB protein (mitochondrion) [Nicotiana tabacum] Length = 156 Score = 85.9 bits (211), Expect = 3e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 119 MPQLDKFTYFTQFFWLCLLFFTFYIAICNDGDGVLGISR 3 MPQLDKFTYFTQFFWLCL FFTFYI+ICNDGDGVLGISR Sbjct: 1 MPQLDKFTYFTQFFWLCLFFFTFYISICNDGDGVLGISR 39 >ref|YP_005090498.1| ATPase subunit 8 (mitochondrion) [Lotus japonicus] gi|357197362|gb|AET62958.1| ATPase subunit 8 (mitochondrion) [Lotus japonicus] Length = 160 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = -2 Query: 119 MPQLDKFTYFTQFFWLCLLFFTFYIAICNDGDGVLGISR 3 MPQLDKFTYFTQFFWLCL FFTFYI ICNDGDGVLGISR Sbjct: 1 MPQLDKFTYFTQFFWLCLFFFTFYILICNDGDGVLGISR 39 >ref|YP_005090447.1| ATPase subunit 8 (mitochondrion) [Millettia pinnata] gi|357197310|gb|AET62907.1| ATPase subunit 8 (mitochondrion) [Millettia pinnata] Length = 160 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = -2 Query: 119 MPQLDKFTYFTQFFWLCLLFFTFYIAICNDGDGVLGISR 3 MPQLDKFTYFTQFFWLCL FFTFYI ICNDGDGVLGISR Sbjct: 1 MPQLDKFTYFTQFFWLCLFFFTFYILICNDGDGVLGISR 39 >ref|XP_002335238.1| predicted protein [Populus trichocarpa] gi|222833196|gb|EEE71673.1| predicted protein [Populus trichocarpa] Length = 157 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = -2 Query: 119 MPQLDKFTYFTQFFWLCLLFFTFYIAICNDGDGVLGISR 3 MPQLDKFTYFTQFFWLCL FFTFYI ICNDGDGVLGISR Sbjct: 1 MPQLDKFTYFTQFFWLCLFFFTFYIKICNDGDGVLGISR 39