BLASTX nr result
ID: Coptis21_contig00041267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00041267 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520334.1| metal transporter, putative [Ricinus communi... 58 9e-07 ref|XP_002284550.1| PREDICTED: metal transporter Nramp5-like [Vi... 57 2e-06 ref|XP_004149810.1| PREDICTED: metal transporter Nramp5-like [Cu... 57 2e-06 gb|AFQ37304.1| natural resistance-associated macrophage protein ... 57 2e-06 emb|CBI18987.3| unnamed protein product [Vitis vinifera] 57 2e-06 >ref|XP_002520334.1| metal transporter, putative [Ricinus communis] gi|223540553|gb|EEF42120.1| metal transporter, putative [Ricinus communis] Length = 528 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 173 TQKKSACRNFLSFVGPGFLVSLAYLDPGNLETD 271 T +KS R F+S+VGPGFLVSLAYLDPGNLETD Sbjct: 32 THQKSGWRKFISYVGPGFLVSLAYLDPGNLETD 64 >ref|XP_002284550.1| PREDICTED: metal transporter Nramp5-like [Vitis vinifera] Length = 544 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 179 KKSACRNFLSFVGPGFLVSLAYLDPGNLETD 271 +K RNFL+FVGPGFLVSLAYLDPGNLETD Sbjct: 25 QKPGWRNFLAFVGPGFLVSLAYLDPGNLETD 55 >ref|XP_004149810.1| PREDICTED: metal transporter Nramp5-like [Cucumis sativus] gi|449499093|ref|XP_004160719.1| PREDICTED: metal transporter Nramp5-like [Cucumis sativus] Length = 549 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 173 TQKKSACRNFLSFVGPGFLVSLAYLDPGNLETD 271 T +K R FLS+VGPGFLVSLAYLDPGNLETD Sbjct: 44 THQKPGWRKFLSYVGPGFLVSLAYLDPGNLETD 76 >gb|AFQ37304.1| natural resistance-associated macrophage protein 1 [Arachis hypogaea] Length = 545 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +2 Query: 152 VKMESENTQKKSACRNFLSFVGPGFLVSLAYLDPGNLETD 271 + ++ + +K + FLSF+GPGFLVSLAYLDPGNLETD Sbjct: 34 IHADASSNHEKKGWKKFLSFIGPGFLVSLAYLDPGNLETD 73 >emb|CBI18987.3| unnamed protein product [Vitis vinifera] Length = 535 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 182 KSACRNFLSFVGPGFLVSLAYLDPGNLETD 271 K RNFL+FVGPGFLVSLAYLDPGNLETD Sbjct: 13 KPGWRNFLAFVGPGFLVSLAYLDPGNLETD 42