BLASTX nr result
ID: Coptis21_contig00041213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00041213 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_199236.1| pentatricopeptide repeat-containing protein [Ar... 62 1e-14 ref|XP_002865376.1| pentatricopeptide repeat-containing protein ... 62 4e-14 ref|XP_002275884.1| PREDICTED: putative pentatricopeptide repeat... 60 6e-14 emb|CBI30347.3| unnamed protein product [Vitis vinifera] 60 6e-14 ref|XP_002442156.1| hypothetical protein SORBIDRAFT_08g015260 [S... 61 6e-14 >ref|NP_199236.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170229|sp|Q9FFG8.1|PP417_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g44230 gi|9759524|dbj|BAB10990.1| selenium-binding protein-like [Arabidopsis thaliana] gi|91806984|gb|ABE66219.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332007694|gb|AED95077.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 657 Score = 62.4 bits (150), Expect(2) = 1e-14 Identities = 33/76 (43%), Positives = 47/76 (61%) Frame = +1 Query: 1 LVAPYSGTAVQGC*VQDATMQVLRMTEDYGVERSVDHCGRLVDLLGREGHVEEACDLVRN 180 + +SG QG V D+ M + +GV+ + DH +VDLLGR G ++EA +L++ Sbjct: 393 MACSHSGLVDQGRQVFDS------MYQTFGVQPTRDHYTCMVDLLGRTGRLQEALELIKT 446 Query: 181 MKVQPHVGVWGALLAA 228 M V+PH GVWGALL A Sbjct: 447 MSVEPHGGVWGALLGA 462 Score = 41.6 bits (96), Expect(2) = 1e-14 Identities = 20/42 (47%), Positives = 29/42 (69%), Gaps = 5/42 (11%) Frame = +3 Query: 225 GIWGS-----GVYHNVEIGKIAAEKLFIMEPENRGNYAILSN 335 G+WG+ +++N EI +IAAE LF +EP+ GNY +LSN Sbjct: 454 GVWGALLGACRIHNNPEIAEIAAEHLFELEPDIIGNYILLSN 495 >ref|XP_002865376.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297311211|gb|EFH41635.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 658 Score = 62.0 bits (149), Expect(2) = 4e-14 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +1 Query: 73 MTEDYGVERSVDHCGRLVDLLGREGHVEEACDLVRNMKVQPHVGVWGALLAA 228 M + +GVE + DH +VDLLGR G ++EA +L++ M V+PH GVWGALL A Sbjct: 412 MYQTFGVEPTRDHYTCMVDLLGRAGRLQEALELIKTMSVEPHGGVWGALLGA 463 Score = 40.4 bits (93), Expect(2) = 4e-14 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 5/42 (11%) Frame = +3 Query: 225 GIWGS-----GVYHNVEIGKIAAEKLFIMEPENRGNYAILSN 335 G+WG+ +++N +I +IAAE LF +EP+ GNY +LSN Sbjct: 455 GVWGALLGACRIHNNPDIAEIAAEHLFELEPDIIGNYILLSN 496 >ref|XP_002275884.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570 [Vitis vinifera] Length = 561 Score = 60.5 bits (145), Expect(2) = 6e-14 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = +1 Query: 73 MTEDYGVERSVDHCGRLVDLLGREGHVEEACDLVRNMKVQPHVGVWGALLAA 228 M DY + S DH +VDLLGR G ++EA +L+++M V+PH G WGALL A Sbjct: 445 MKTDYSIVPSPDHYACMVDLLGRAGRLKEAYELLKSMPVEPHAGAWGALLGA 496 Score = 41.6 bits (96), Expect(2) = 6e-14 Identities = 17/42 (40%), Positives = 30/42 (71%), Gaps = 5/42 (11%) Frame = +3 Query: 225 GIWGS-----GVYHNVEIGKIAAEKLFIMEPENRGNYAILSN 335 G WG+ ++ ++E+G++ A++LF +EP+N GNY +LSN Sbjct: 488 GAWGALLGACKLHCDIELGEVVADQLFELEPQNAGNYVLLSN 529 >emb|CBI30347.3| unnamed protein product [Vitis vinifera] Length = 560 Score = 60.5 bits (145), Expect(2) = 6e-14 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = +1 Query: 73 MTEDYGVERSVDHCGRLVDLLGREGHVEEACDLVRNMKVQPHVGVWGALLAA 228 M DY + S DH +VDLLGR G ++EA +L+++M V+PH G WGALL A Sbjct: 444 MKTDYSIVPSPDHYACMVDLLGRAGRLKEAYELLKSMPVEPHAGAWGALLGA 495 Score = 41.6 bits (96), Expect(2) = 6e-14 Identities = 17/42 (40%), Positives = 30/42 (71%), Gaps = 5/42 (11%) Frame = +3 Query: 225 GIWGS-----GVYHNVEIGKIAAEKLFIMEPENRGNYAILSN 335 G WG+ ++ ++E+G++ A++LF +EP+N GNY +LSN Sbjct: 487 GAWGALLGACKLHCDIELGEVVADQLFELEPQNAGNYVLLSN 528 >ref|XP_002442156.1| hypothetical protein SORBIDRAFT_08g015260 [Sorghum bicolor] gi|241942849|gb|EES15994.1| hypothetical protein SORBIDRAFT_08g015260 [Sorghum bicolor] Length = 557 Score = 61.2 bits (147), Expect(2) = 6e-14 Identities = 30/62 (48%), Positives = 37/62 (59%) Frame = +1 Query: 43 VQDATMQVLRMTEDYGVERSVDHCGRLVDLLGREGHVEEACDLVRNMKVQPHVGVWGALL 222 V D M +Y +E+S DH +VDL GR G +EEA L R M V+PH GVWGAL+ Sbjct: 397 VHDGKFYFESMRTNYAIEQSPDHYACMVDLYGRAGLIEEAYQLARAMPVKPHAGVWGALI 456 Query: 223 AA 228 A Sbjct: 457 NA 458 Score = 40.8 bits (94), Expect(2) = 6e-14 Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 5/42 (11%) Frame = +3 Query: 225 GIWGSGV-----YHNVEIGKIAAEKLFIMEPENRGNYAILSN 335 G+WG+ + + NVE+GK+AA +L +EP N G Y +L+N Sbjct: 450 GVWGALINACRKHCNVEVGKVAARELIAIEPGNPGTYVLLAN 491