BLASTX nr result
ID: Coptis21_contig00041155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00041155 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24015.3| unnamed protein product [Vitis vinifera] 206 1e-51 ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containi... 206 1e-51 ref|XP_003541335.1| PREDICTED: pentatricopeptide repeat-containi... 183 1e-44 ref|XP_002328762.1| predicted protein [Populus trichocarpa] gi|2... 169 2e-40 ref|XP_003564043.1| PREDICTED: pentatricopeptide repeat-containi... 162 3e-38 >emb|CBI24015.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 206 bits (525), Expect = 1e-51 Identities = 93/114 (81%), Positives = 109/114 (95%) Frame = -1 Query: 350 GVNEFIAGGRGHPQAKEIYAKVDEMLERMKCAGYVPNTDGVLHDVEEEDRENPLHYHSEK 171 GV+EFIAGGR HPQAKEIYAK+DE+LE ++ GYVP+TDGVLHD++EE++ENPL+YHSEK Sbjct: 445 GVDEFIAGGRAHPQAKEIYAKLDEILETIRSIGYVPDTDGVLHDIDEEEKENPLYYHSEK 504 Query: 170 LAIAFGLLKTKPGATIRISKNLRVCRDCHQASKLISKIFDREIIVRDRNRFHHF 9 LAIAFGLLKTKPG T+RISKNLR+CRDCHQASKLISK++DREII+RDRNRFHHF Sbjct: 505 LAIAFGLLKTKPGETLRISKNLRICRDCHQASKLISKVYDREIIIRDRNRFHHF 558 >ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 624 Score = 206 bits (525), Expect = 1e-51 Identities = 93/114 (81%), Positives = 109/114 (95%) Frame = -1 Query: 350 GVNEFIAGGRGHPQAKEIYAKVDEMLERMKCAGYVPNTDGVLHDVEEEDRENPLHYHSEK 171 GV+EFIAGGR HPQAKEIYAK+DE+LE ++ GYVP+TDGVLHD++EE++ENPL+YHSEK Sbjct: 500 GVDEFIAGGRAHPQAKEIYAKLDEILETIRSIGYVPDTDGVLHDIDEEEKENPLYYHSEK 559 Query: 170 LAIAFGLLKTKPGATIRISKNLRVCRDCHQASKLISKIFDREIIVRDRNRFHHF 9 LAIAFGLLKTKPG T+RISKNLR+CRDCHQASKLISK++DREII+RDRNRFHHF Sbjct: 560 LAIAFGLLKTKPGETLRISKNLRICRDCHQASKLISKVYDREIIIRDRNRFHHF 613 >ref|XP_003541335.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] Length = 607 Score = 183 bits (464), Expect = 1e-44 Identities = 83/116 (71%), Positives = 103/116 (88%) Frame = -1 Query: 353 GGVNEFIAGGRGHPQAKEIYAKVDEMLERMKCAGYVPNTDGVLHDVEEEDRENPLHYHSE 174 G VNEF+AGGR HP A+ IYAK+ EMLE ++ G+VP+TDGVLHD+ EE+RENPL YHSE Sbjct: 482 GVVNEFVAGGRDHPLAEAIYAKIYEMLESIRVVGFVPDTDGVLHDLVEEERENPLFYHSE 541 Query: 173 KLAIAFGLLKTKPGATIRISKNLRVCRDCHQASKLISKIFDREIIVRDRNRFHHFS 6 KLAIA+GLLKTK G T+R++KNLRVC+DCHQASK+ISK++D +II+RDR+RFHHFS Sbjct: 542 KLAIAYGLLKTKRGETLRVTKNLRVCKDCHQASKMISKVYDCDIIIRDRSRFHHFS 597 >ref|XP_002328762.1| predicted protein [Populus trichocarpa] gi|222839060|gb|EEE77411.1| predicted protein [Populus trichocarpa] Length = 632 Score = 169 bits (429), Expect = 2e-40 Identities = 84/118 (71%), Positives = 95/118 (80%), Gaps = 3/118 (2%) Frame = -1 Query: 353 GGVNEFIAGGRGHPQAKEIYAKVDEMLERMKCAGYVPNTDGVLHDV---EEEDRENPLHY 183 G V+EFIAG R HPQAKE++AKV EMLE +K GYV +T+GVLH EEED ENPL+Y Sbjct: 504 GTVHEFIAGERNHPQAKELHAKVYEMLEHLKSVGYVADTNGVLHGHDFDEEEDGENPLYY 563 Query: 182 HSEKLAIAFGLLKTKPGATIRISKNLRVCRDCHQASKLISKIFDREIIVRDRNRFHHF 9 HSEKLAIAFGL +TKPG T+RI KNLR+C DCH A KLIS +FDREIIVRDR RFH F Sbjct: 564 HSEKLAIAFGLSRTKPGETLRILKNLRICEDCHHACKLISTVFDREIIVRDRTRFHRF 621 >ref|XP_003564043.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Brachypodium distachyon] Length = 599 Score = 162 bits (410), Expect = 3e-38 Identities = 73/115 (63%), Positives = 94/115 (81%) Frame = -1 Query: 353 GGVNEFIAGGRGHPQAKEIYAKVDEMLERMKCAGYVPNTDGVLHDVEEEDRENPLHYHSE 174 G V EF G H Q KEI+A V +M+ +++ GY+P+T VLHD+ EE++E PL YHSE Sbjct: 474 GEVCEFQCGSLCHAQEKEIFAAVKDMMRKIRLEGYMPDTSDVLHDITEEEKEVPLQYHSE 533 Query: 173 KLAIAFGLLKTKPGATIRISKNLRVCRDCHQASKLISKIFDREIIVRDRNRFHHF 9 KLAIAFGLL+T+PG T+RI+KNLRVCRDCH+A+K IS++F+REI+VRDRNRFHHF Sbjct: 534 KLAIAFGLLRTRPGDTVRITKNLRVCRDCHEATKFISRVFEREIVVRDRNRFHHF 588