BLASTX nr result
ID: Coptis21_contig00041124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00041124 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518527.1| pentatricopeptide repeat-containing protein,... 63 3e-08 ref|XP_002305605.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 >ref|XP_002518527.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542372|gb|EEF43914.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 599 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/61 (44%), Positives = 36/61 (59%) Frame = -2 Query: 198 NWFPXXXXXXXXXXXLTPYVFTQVLHKLEKDPHLSLTFFNWAKTNLEYKPDFKSHCKLVQ 19 NW P TP++F Q+LHK + +SL FFNWAKTNL + PD KS C ++Q Sbjct: 65 NWIPLLQNLNLSSKL-TPFLFFQILHKTQTHAQISLNFFNWAKTNLNFNPDLKSQCHVIQ 123 Query: 18 I 16 + Sbjct: 124 L 124 >ref|XP_002305605.1| predicted protein [Populus trichocarpa] gi|222848569|gb|EEE86116.1| predicted protein [Populus trichocarpa] Length = 564 Score = 61.2 bits (147), Expect = 8e-08 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = -2 Query: 150 TPYVFTQVLHKLEKDPHLSLTFFNWAKTNLEYKPDFKSHCKLVQI 16 TP +F Q+LHK + +P +SL FFNW +TNL+ KPD KS C ++ I Sbjct: 51 TPPLFNQILHKTQTNPQISLRFFNWVQTNLKLKPDLKSQCHIINI 95 >ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21170-like [Vitis vinifera] Length = 569 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/96 (29%), Positives = 44/96 (45%) Frame = -2 Query: 303 NFEAFVRADMSLKWRKXXXXXXXXXXXXXXXXXXQNWFPXXXXXXXXXXXLTPYVFTQVL 124 +F F ++ L WR NW TP +F Q+L Sbjct: 9 SFNQFSKSTTPLNWRAQIKQNQLISQISSILLQRHNWVTLLRNFNLSSKL-TPSLFHQIL 67 Query: 123 HKLEKDPHLSLTFFNWAKTNLEYKPDFKSHCKLVQI 16 K +K+P SL+FFNW +TNL ++PD +H ++++I Sbjct: 68 LKTQKNPQSSLSFFNWVRTNLGFQPDLAAHSQIIRI 103