BLASTX nr result
ID: Coptis21_contig00040960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00040960 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631269.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 102 4e-20 emb|CBI28530.3| unnamed protein product [Vitis vinifera] 102 4e-20 ref|XP_002514722.1| pentatricopeptide repeat-containing protein,... 96 4e-18 ref|XP_004138304.1| PREDICTED: pentatricopeptide repeat-containi... 92 3e-17 ref|XP_002318601.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 >ref|XP_003631269.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Vitis vinifera] Length = 505 Score = 102 bits (253), Expect = 4e-20 Identities = 45/73 (61%), Positives = 59/73 (80%) Frame = +1 Query: 121 ELCNIVSNGIGGLDELESSLNSSKALITPFLVTQVLDSCKNEVPTRRLLRFFSWSNKRPE 300 ELCN+VSNG+G LD+LE+SL+ A T L++Q+LD+CKNE PTRRLLRFF WS+K+ Sbjct: 42 ELCNVVSNGVGSLDDLEASLDRLDASFTSSLISQILDTCKNEAPTRRLLRFFLWSSKKFN 101 Query: 301 CRFEDGDFNHAIR 339 C+ ED DFN+AI+ Sbjct: 102 CKLEDDDFNYAIQ 114 >emb|CBI28530.3| unnamed protein product [Vitis vinifera] Length = 452 Score = 102 bits (253), Expect = 4e-20 Identities = 45/73 (61%), Positives = 59/73 (80%) Frame = +1 Query: 121 ELCNIVSNGIGGLDELESSLNSSKALITPFLVTQVLDSCKNEVPTRRLLRFFSWSNKRPE 300 ELCN+VSNG+G LD+LE+SL+ A T L++Q+LD+CKNE PTRRLLRFF WS+K+ Sbjct: 11 ELCNVVSNGVGSLDDLEASLDRLDASFTSSLISQILDTCKNEAPTRRLLRFFLWSSKKFN 70 Query: 301 CRFEDGDFNHAIR 339 C+ ED DFN+AI+ Sbjct: 71 CKLEDDDFNYAIQ 83 >ref|XP_002514722.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546326|gb|EEF47828.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 479 Score = 95.5 bits (236), Expect = 4e-18 Identities = 45/76 (59%), Positives = 56/76 (73%) Frame = +1 Query: 112 DFNELCNIVSNGIGGLDELESSLNSSKALITPFLVTQVLDSCKNEVPTRRLLRFFSWSNK 291 + E+C VS+ IGGLD+LESSLN + +T +VTQV+D CK+E PTRRLLRFF WS K Sbjct: 24 ELQEICKAVSSSIGGLDDLESSLNGFRGNLTSQIVTQVIDCCKHEAPTRRLLRFFLWSYK 83 Query: 292 RPECRFEDGDFNHAIR 339 R + +D DFNHAIR Sbjct: 84 RLDFSMKDEDFNHAIR 99 >ref|XP_004138304.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Cucumis sativus] gi|449477571|ref|XP_004155060.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Cucumis sativus] Length = 487 Score = 92.4 bits (228), Expect = 3e-17 Identities = 56/108 (51%), Positives = 64/108 (59%), Gaps = 5/108 (4%) Frame = +1 Query: 31 SLLKPKLTHIFTPTKLVFHFKHFSHSTDFN-----ELCNIVSNGIGGLDELESSLNSSKA 195 SLLK K + H HST N +LC ++S IGGLDELESSLN Sbjct: 17 SLLKLKWDSFIAQSVCTQHRFCSLHSTVNNGAAVSKLCEVISCTIGGLDELESSLNKCTI 76 Query: 196 LITPFLVTQVLDSCKNEVPTRRLLRFFSWSNKRPECRFEDGDFNHAIR 339 +T LVTQV+DS KNE PTRRLLRFF WS K+ ED DFN+AIR Sbjct: 77 SLTSSLVTQVIDSSKNEAPTRRLLRFFLWSLKKLNHTLEDEDFNNAIR 124 >ref|XP_002318601.1| predicted protein [Populus trichocarpa] gi|222859274|gb|EEE96821.1| predicted protein [Populus trichocarpa] Length = 485 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 1/84 (1%) Frame = +1 Query: 91 KHFSHSTDFNELCNIVSNGIGGLDELESSLNSSKALITPFLVTQVLDSCKNEVPTRRLLR 270 +H + E C ++S+ IGGLD+LE SLN K +T LVTQ+++SCK+E P+RR+LR Sbjct: 32 QHNQLPLELQEACKVISSWIGGLDDLELSLNQFKGQLTYPLVTQIINSCKHEAPSRRILR 91 Query: 271 FFSWSNKRPEC-RFEDGDFNHAIR 339 FF WSNK + + +D DFNH IR Sbjct: 92 FFLWSNKVLDSEKLKDDDFNHVIR 115