BLASTX nr result
ID: Coptis21_contig00040928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00040928 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509570.1| conserved hypothetical protein [Ricinus comm... 68 9e-10 gb|AFK34152.1| unknown [Lotus japonicus] 67 2e-09 ref|XP_002884262.1| hypothetical protein ARALYDRAFT_896070 [Arab... 65 4e-09 ref|NP_566150.1| Mitochondrial ribosomal protein L37 [Arabidopsi... 65 6e-09 ref|XP_003620189.1| hypothetical protein MTR_6g078300 [Medicago ... 65 6e-09 >ref|XP_002509570.1| conserved hypothetical protein [Ricinus communis] gi|223549469|gb|EEF50957.1| conserved hypothetical protein [Ricinus communis] Length = 130 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 320 LRRKNIETLPYEHLKRFVKLDNRSRIKENNSIKAKN 213 LRRKNIETLPYE LKRFVKLDNR+ IKENNS+KAKN Sbjct: 95 LRRKNIETLPYEDLKRFVKLDNRASIKENNSVKAKN 130 >gb|AFK34152.1| unknown [Lotus japonicus] Length = 131 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -2 Query: 320 LRRKNIETLPYEHLKRFVKLDNRSRIKENNSIKAKN 213 LRRKNIETL YE+LKR+VKLDNR+RIKENNS+KAKN Sbjct: 96 LRRKNIETLSYEYLKRYVKLDNRARIKENNSLKAKN 131 >ref|XP_002884262.1| hypothetical protein ARALYDRAFT_896070 [Arabidopsis lyrata subsp. lyrata] gi|297330102|gb|EFH60521.1| hypothetical protein ARALYDRAFT_896070 [Arabidopsis lyrata subsp. lyrata] Length = 125 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -2 Query: 320 LRRKNIETLPYEHLKRFVKLDNRSRIKENNSIKAKN 213 LRRKN+ETLPY+ LKRFVKLD R++IKENNSIKAKN Sbjct: 90 LRRKNVETLPYDDLKRFVKLDTRAKIKENNSIKAKN 125 >ref|NP_566150.1| Mitochondrial ribosomal protein L37 [Arabidopsis thaliana] gi|6016731|gb|AAF01557.1|AC009325_27 unknown protein [Arabidopsis thaliana] gi|6091718|gb|AAF03430.1|AC010797_6 unknown protein [Arabidopsis thaliana] gi|21592342|gb|AAM64293.1| unknown [Arabidopsis thaliana] gi|28393066|gb|AAO41967.1| unknown protein [Arabidopsis thaliana] gi|28827392|gb|AAO50540.1| unknown protein [Arabidopsis thaliana] gi|332640188|gb|AEE73709.1| Mitochondrial ribosomal protein L37 [Arabidopsis thaliana] Length = 126 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 320 LRRKNIETLPYEHLKRFVKLDNRSRIKENNSIKAKN 213 LRRKN+ETLPY+ LKRFVKLD R +IKENNSIKAKN Sbjct: 91 LRRKNVETLPYDDLKRFVKLDTRGKIKENNSIKAKN 126 >ref|XP_003620189.1| hypothetical protein MTR_6g078300 [Medicago truncatula] gi|217069986|gb|ACJ83353.1| unknown [Medicago truncatula] gi|355495204|gb|AES76407.1| hypothetical protein MTR_6g078300 [Medicago truncatula] gi|388518995|gb|AFK47559.1| unknown [Medicago truncatula] Length = 131 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -2 Query: 320 LRRKNIETLPYEHLKRFVKLDNRSRIKENNSIKAKN 213 LRRK I+TLPYE LKR+VKLDNR+RIKENNS+KAKN Sbjct: 96 LRRKEIDTLPYEDLKRYVKLDNRARIKENNSLKAKN 131