BLASTX nr result
ID: Coptis21_contig00040809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00040809 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267486.1| PREDICTED: putative pentatricopeptide repeat... 60 2e-07 ref|NP_173127.4| pentatricopeptide repeat-containing protein [Ar... 56 3e-06 >ref|XP_002267486.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vitis vinifera] gi|297735747|emb|CBI18434.3| unnamed protein product [Vitis vinifera] Length = 659 Score = 60.1 bits (144), Expect = 2e-07 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 3/86 (3%) Frame = -1 Query: 259 DWYSYIXXXXXXXXXXXLDKAIRVF---VTNDLFHDVHVLTLMIAELIRLGRLDTAIRIF 89 D YS++ +D+A+ V+ + N D H+ T++I LI+ G+ A+R+F Sbjct: 433 DQYSFVGLLSGLCGSGRVDEAVNVYSGILVNHSDLDAHIHTVIIGGLIKAGKFHRAVRLF 492 Query: 88 SKAVEEKFPLDVVSYTVVICGLVKVG 11 KA+ E++ LD VSYTV I GL+K G Sbjct: 493 KKAMVERYTLDAVSYTVAIYGLLKGG 518 >ref|NP_173127.4| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806394|sp|Q3EDA9.2|PPR46_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At1g16830 gi|332191383|gb|AEE29504.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 608 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/62 (41%), Positives = 39/62 (62%) Frame = -1 Query: 202 KAIRVFVTNDLFHDVHVLTLMIAELIRLGRLDTAIRIFSKAVEEKFPLDVVSYTVVICGL 23 K ++ + D H + +I LI LG+ +TA+ +F + + EK+PLDVVSYTV I GL Sbjct: 440 KMYKIIIKEKKHLDAHFHSAIIDSLIELGKYNTAVHLFKRCILEKYPLDVVSYTVAIKGL 499 Query: 22 VK 17 V+ Sbjct: 500 VR 501