BLASTX nr result
ID: Coptis21_contig00040619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00040619 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518685.1| Interleukin-1 receptor-associated kinase, pu... 98 6e-19 ref|XP_002883890.1| hypothetical protein ARALYDRAFT_480399 [Arab... 96 3e-18 ref|XP_002300237.1| predicted protein [Populus trichocarpa] gi|2... 95 5e-18 ref|NP_179911.1| Leucine-rich repeat protein kinase family prote... 94 1e-17 ref|XP_002524923.1| LIM domain kinase, putative [Ricinus communi... 92 3e-17 >ref|XP_002518685.1| Interleukin-1 receptor-associated kinase, putative [Ricinus communis] gi|223542066|gb|EEF43610.1| Interleukin-1 receptor-associated kinase, putative [Ricinus communis] Length = 736 Score = 98.2 bits (243), Expect = 6e-19 Identities = 48/83 (57%), Positives = 62/83 (74%), Gaps = 4/83 (4%) Frame = -2 Query: 237 FLLPSLVPSLALNPDGVLLLYLKNSVLSDPFSMLQNWNHNDETPCSWNGVLCTPVRTEWS 58 FL+ LVP+ ALN DG+LLL K S LSDP S+L++WN++D+TPCSWNGV CT + + + Sbjct: 17 FLVLGLVPTFALNTDGILLLSFKYSTLSDPLSVLESWNYDDDTPCSWNGVTCTELGLQGT 76 Query: 57 ----RVISLVLPNSQLSGSIPSE 1 RV SLVLP+SQL GSIP + Sbjct: 77 PDMFRVTSLVLPSSQLLGSIPPD 99 >ref|XP_002883890.1| hypothetical protein ARALYDRAFT_480399 [Arabidopsis lyrata subsp. lyrata] gi|297329730|gb|EFH60149.1| hypothetical protein ARALYDRAFT_480399 [Arabidopsis lyrata subsp. lyrata] Length = 744 Score = 95.9 bits (237), Expect = 3e-18 Identities = 54/97 (55%), Positives = 65/97 (67%), Gaps = 4/97 (4%) Frame = -2 Query: 288 SIRSNNPNFCLRFCTIFFLLPSLVPSLALNPDGVLLLYLKNSVLSDPFSMLQNWNHNDET 109 SIRSN L F F LLP+L+ ALN DGV LL K S+L+DP S+L+NWN++DET Sbjct: 3 SIRSN-----LFFHLFFLLLPTLIQ--ALNTDGVALLSFKYSILNDPLSVLRNWNYDDET 55 Query: 108 PCSWNGVLCTPVRT----EWSRVISLVLPNSQLSGSI 10 PCSW GV CT + T + RV SLVLPN QL GS+ Sbjct: 56 PCSWTGVTCTELGTPNTPDMLRVTSLVLPNKQLLGSV 92 >ref|XP_002300237.1| predicted protein [Populus trichocarpa] gi|222847495|gb|EEE85042.1| predicted protein [Populus trichocarpa] Length = 757 Score = 95.1 bits (235), Expect = 5e-18 Identities = 48/84 (57%), Positives = 57/84 (67%), Gaps = 4/84 (4%) Frame = -2 Query: 240 FFLLPSLVPSLALNPDGVLLLYLKNSVLSDPFSMLQNWNHNDETPCSWNGVLCT----PV 73 FFLL +P+ ALN DGVLLL K S+L DP S+L+ WN+ D+TPC W GV CT P Sbjct: 14 FFLLGIALPTFALNTDGVLLLSFKYSILRDPLSVLETWNYEDKTPCFWKGVTCTELGLPG 73 Query: 72 RTEWSRVISLVLPNSQLSGSIPSE 1 + RV SLVLPNSQL GSIP + Sbjct: 74 TPDMFRVTSLVLPNSQLLGSIPPD 97 >ref|NP_179911.1| Leucine-rich repeat protein kinase family protein [Arabidopsis thaliana] gi|2642433|gb|AAB87101.1| putative receptor-like protein kinase [Arabidopsis thaliana] gi|224589517|gb|ACN59292.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|330252344|gb|AEC07438.1| Leucine-rich repeat protein kinase family protein [Arabidopsis thaliana] Length = 773 Score = 93.6 bits (231), Expect = 1e-17 Identities = 52/98 (53%), Positives = 64/98 (65%), Gaps = 1/98 (1%) Frame = -2 Query: 291 MSIRSNNPNFCLRFCTIFFLLPSL-VPSLALNPDGVLLLYLKNSVLSDPFSMLQNWNHND 115 M +S +P F + F FF SL + S ALN DGVLLL K SVL DP S+LQ+WN++ Sbjct: 1 MKTQSASPFFFVSFFFFFFFFSSLFLLSSALNSDGVLLLSFKYSVLLDPLSLLQSWNYDH 60 Query: 114 ETPCSWNGVLCTPVRTEWSRVISLVLPNSQLSGSIPSE 1 + PCSW GVLC SRV++L LPNS L GSIPS+ Sbjct: 61 DNPCSWRGVLC----NNDSRVVTLSLPNSNLVGSIPSD 94 >ref|XP_002524923.1| LIM domain kinase, putative [Ricinus communis] gi|223535758|gb|EEF37420.1| LIM domain kinase, putative [Ricinus communis] Length = 785 Score = 92.4 bits (228), Expect = 3e-17 Identities = 47/81 (58%), Positives = 58/81 (71%), Gaps = 3/81 (3%) Frame = -2 Query: 234 LLPSLVPSLALNPDGVLLLYLKNSVLSDPFSMLQNWNHNDETPCSWNGVLCTPV---RTE 64 LL +V S LN DG+LLL LK S+LSDP +L++W++NDETPCSWNGV C T Sbjct: 21 LLLLVVQSFGLNTDGILLLSLKFSILSDPLRVLESWSYNDETPCSWNGVTCGGPGLDATS 80 Query: 63 WSRVISLVLPNSQLSGSIPSE 1 +SRV L LPNSQL GSIP++ Sbjct: 81 FSRVTGLSLPNSQLLGSIPAD 101