BLASTX nr result
ID: Coptis21_contig00040613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00040613 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32068.3| unnamed protein product [Vitis vinifera] 40 6e-06 ref|XP_002267856.2| PREDICTED: paired amphipathic helix protein ... 40 6e-06 >emb|CBI32068.3| unnamed protein product [Vitis vinifera] Length = 1445 Score = 39.7 bits (91), Expect(2) = 6e-06 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = -1 Query: 156 EIEEIIKYSCNEVCTTTQQLQKVMRI*TTVFRTNVG 49 ++ ++IKYSC EVC TT+QL KVM+I TT +G Sbjct: 736 DLYQLIKYSCGEVC-TTEQLDKVMKIWTTFLEPMLG 770 Score = 35.0 bits (79), Expect(2) = 6e-06 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 68 FLEPMLGISPWQQGTEDSEDVV 3 FLEPMLG+ QG EDSEDVV Sbjct: 764 FLEPMLGVPSRPQGAEDSEDVV 785 >ref|XP_002267856.2| PREDICTED: paired amphipathic helix protein Sin3-like 4-like [Vitis vinifera] Length = 1421 Score = 39.7 bits (91), Expect(2) = 6e-06 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = -1 Query: 156 EIEEIIKYSCNEVCTTTQQLQKVMRI*TTVFRTNVG 49 ++ ++IKYSC EVC TT+QL KVM+I TT +G Sbjct: 718 DLYQLIKYSCGEVC-TTEQLDKVMKIWTTFLEPMLG 752 Score = 35.0 bits (79), Expect(2) = 6e-06 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 68 FLEPMLGISPWQQGTEDSEDVV 3 FLEPMLG+ QG EDSEDVV Sbjct: 746 FLEPMLGVPSRPQGAEDSEDVV 767