BLASTX nr result
ID: Coptis21_contig00040592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00040592 (206 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG24500.1| susceptible endoplasmic reticulum auxin-binding p... 62 5e-08 gb|AAG24497.1| resistant endoplasmic reticulum auxin-binding pro... 62 5e-08 ref|NP_192207.1| auxin-binding protein 1 [Arabidopsis thaliana] ... 61 1e-07 ref|XP_002872802.1| hypothetical protein ARALYDRAFT_490264 [Arab... 61 1e-07 gb|AAM64865.1| auxin-binding protein 1 precursor [Arabidopsis th... 61 1e-07 >gb|AAG24500.1| susceptible endoplasmic reticulum auxin-binding protein 1b [Sinapis arvensis] Length = 199 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -2 Query: 112 VNGIPIVRNVSELPQSDHGSERLSHMTVAGSLLHGMK 2 +NG+PIVRN+SELPQ ++G LSHMTVAGS+LHGMK Sbjct: 39 INGLPIVRNISELPQDNYGRPGLSHMTVAGSVLHGMK 75 >gb|AAG24497.1| resistant endoplasmic reticulum auxin-binding protein 1 [Sinapis arvensis] Length = 198 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -2 Query: 112 VNGIPIVRNVSELPQSDHGSERLSHMTVAGSLLHGMK 2 +NG+PIVRN+SELPQ ++G LSHMTVAGS+LHGMK Sbjct: 38 INGLPIVRNISELPQDNYGRPGLSHMTVAGSVLHGMK 74 >ref|NP_192207.1| auxin-binding protein 1 [Arabidopsis thaliana] gi|461453|sp|P33487.1|ABP1_ARATH RecName: Full=Auxin-binding protein 1; Short=ABP; Flags: Precursor gi|14488061|gb|AAK63851.1|AF389278_1 AT4g02980/T4I9_14 [Arabidopsis thaliana] gi|16201|emb|CAA49526.1| auxin-binding protein [Arabidopsis thaliana] gi|251899|gb|AAB22612.1| At-ERabp1 [Arabidopsis thaliana] gi|3924607|gb|AAC79108.1| auxin-binding protein 1 precursor [Arabidopsis thaliana] gi|7269783|emb|CAB77783.1| auxin-binding protein 1 precursor [Arabidopsis thaliana] gi|20147329|gb|AAM10378.1| AT4g02980/T4I9_14 [Arabidopsis thaliana] gi|332656856|gb|AEE82256.1| auxin-binding protein 1 [Arabidopsis thaliana] Length = 198 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -2 Query: 112 VNGIPIVRNVSELPQSDHGSERLSHMTVAGSLLHGMK 2 +NG+PIVRN+S+LPQ ++G LSHMTVAGS+LHGMK Sbjct: 38 INGLPIVRNISDLPQDNYGRPGLSHMTVAGSVLHGMK 74 >ref|XP_002872802.1| hypothetical protein ARALYDRAFT_490264 [Arabidopsis lyrata subsp. lyrata] gi|297318639|gb|EFH49061.1| hypothetical protein ARALYDRAFT_490264 [Arabidopsis lyrata subsp. lyrata] Length = 198 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -2 Query: 112 VNGIPIVRNVSELPQSDHGSERLSHMTVAGSLLHGMK 2 +NG+PIVRN+S+LPQ ++G LSHMTVAGS+LHGMK Sbjct: 38 INGLPIVRNISDLPQDNYGRPGLSHMTVAGSVLHGMK 74 >gb|AAM64865.1| auxin-binding protein 1 precursor [Arabidopsis thaliana] Length = 198 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -2 Query: 112 VNGIPIVRNVSELPQSDHGSERLSHMTVAGSLLHGMK 2 +NG+PIVRN+S+LPQ ++G LSHMTVAGS+LHGMK Sbjct: 38 INGLPIVRNISDLPQDNYGRPGLSHMTVAGSVLHGMK 74