BLASTX nr result
ID: Coptis21_contig00039868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00039868 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271971.1| PREDICTED: protein FEZ [Vitis vinifera] 62 4e-08 >ref|XP_002271971.1| PREDICTED: protein FEZ [Vitis vinifera] Length = 377 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -2 Query: 165 LPSSSHSQSLVLNTLPNTI-TNFSDKLWEWNPIPDSHRDYTGPFK 34 LP SQSL LNTLP ++ FSD+LWEWNPIP++ RDY PFK Sbjct: 333 LPVPQSSQSLALNTLPGSLQAAFSDRLWEWNPIPEASRDYNSPFK 377