BLASTX nr result
ID: Coptis21_contig00039860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00039860 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330082.1| predicted protein [Populus trichocarpa] gi|2... 79 5e-13 ref|XP_002512521.1| pentatricopeptide repeat-containing protein,... 77 1e-12 ref|XP_004170418.1| PREDICTED: pentatricopeptide repeat-containi... 73 3e-11 ref|XP_004135765.1| PREDICTED: pentatricopeptide repeat-containi... 72 5e-11 emb|CBI39605.3| unnamed protein product [Vitis vinifera] 61 1e-07 >ref|XP_002330082.1| predicted protein [Populus trichocarpa] gi|222871507|gb|EEF08638.1| predicted protein [Populus trichocarpa] Length = 665 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/68 (52%), Positives = 55/68 (80%), Gaps = 1/68 (1%) Frame = +2 Query: 32 TRLSQQTLSNLLDTKGTKSLQHLKQIHTLIIRYGLFQDNYIAGSLVKCY-SIHFNSLDTA 208 ++LSQ+T+ +LL+TK + SL HLKQ+H + +R G FQD+Y++G+LVKCY + HF++L+ A Sbjct: 24 SQLSQKTILDLLNTKSSTSLHHLKQVHAVALRTGHFQDHYVSGTLVKCYANPHFSNLNFA 83 Query: 209 LKAFNHVP 232 LK F +VP Sbjct: 84 LKVFEYVP 91 >ref|XP_002512521.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548482|gb|EEF49973.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 422 Score = 77.0 bits (188), Expect = 1e-12 Identities = 38/85 (44%), Positives = 60/85 (70%), Gaps = 7/85 (8%) Frame = +2 Query: 2 THTPSYHLK------ATRLSQQTLSNLLDTKGTKSLQHLKQIHTLIIRYGLFQDNYIAGS 163 TH P YHL ++L+Q+T+ +LL++K S Q+LKQIH +I+R G F+D+Y++G+ Sbjct: 8 THLP-YHLSPAENKPTSKLTQKTILDLLNSKCNASFQYLKQIHAVILRSGHFEDHYVSGT 66 Query: 164 LVKCY-SIHFNSLDTALKAFNHVPR 235 L+KCY + HF ++D A F+HVP+ Sbjct: 67 LLKCYANPHFKNIDLAFTVFDHVPK 91 >ref|XP_004170418.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Cucumis sativus] Length = 666 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/72 (44%), Positives = 53/72 (73%), Gaps = 1/72 (1%) Frame = +2 Query: 20 HLKATRLSQQTLSNLLDTKGTKSLQHLKQIHTLIIRYGLFQDNYIAGSLVKCY-SIHFNS 196 ++ ++L Q+T+ L D+K SLQ+L Q+H L++R G FQD+Y++G+L+KCY + HF++ Sbjct: 23 NIPTSKLPQKTVLKLFDSKSITSLQYLTQLHALVLRSGHFQDHYVSGALLKCYANPHFSN 82 Query: 197 LDTALKAFNHVP 232 D ALK F+ +P Sbjct: 83 FDFALKVFSSIP 94 >ref|XP_004135765.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Cucumis sativus] Length = 666 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/72 (44%), Positives = 53/72 (73%), Gaps = 1/72 (1%) Frame = +2 Query: 20 HLKATRLSQQTLSNLLDTKGTKSLQHLKQIHTLIIRYGLFQDNYIAGSLVKCY-SIHFNS 196 ++ ++L Q+T+ L D+K SLQ+L Q+H L++R G FQD+Y++G+L+KCY + HF++ Sbjct: 23 NIPTSKLPQKTVLKLFDSKSITSLQYLTQLHGLVLRSGHFQDHYVSGALLKCYANPHFSN 82 Query: 197 LDTALKAFNHVP 232 D ALK F+ +P Sbjct: 83 FDFALKVFSSIP 94 >emb|CBI39605.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 60.8 bits (146), Expect = 1e-07 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 4/72 (5%) Frame = +2 Query: 26 KATRLSQQTLSNLLDTKGTKSLQHLKQIHTLIIRYGLFQDNYIAGSLVKCY----SIHFN 193 + ++LS + + +LL+T+ T SL HLKQ H LI+R G QD+YIAGSLVK Y + + Sbjct: 47 ETSKLSHKAILHLLNTQCTTSLHHLKQAHALILRTGHLQDSYIAGSLVKSYANVSTNRYL 106 Query: 194 SLDTALKAFNHV 229 S +++L+ F+ V Sbjct: 107 SFESSLRVFDFV 118