BLASTX nr result
ID: Coptis21_contig00039602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00039602 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003592239.1| Serine carboxypeptidase-like protein [Medica... 55 6e-06 gb|AAQ63884.1| putative serine carboxypeptidase [Medicago trunca... 55 6e-06 ref|XP_003592242.1| Serine carboxypeptidase-like protein [Medica... 55 8e-06 >ref|XP_003592239.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|357462109|ref|XP_003601336.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355481287|gb|AES62490.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355490384|gb|AES71587.1| Serine carboxypeptidase-like protein [Medicago truncatula] Length = 495 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 57 NDFYPCSDNYVTAYLNLLEVQKSLHTKPTTW 149 NDF PCSD YVTAYLN EVQK+LH KPT W Sbjct: 345 NDFDPCSDYYVTAYLNRPEVQKALHAKPTNW 375 >gb|AAQ63884.1| putative serine carboxypeptidase [Medicago truncatula] Length = 495 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 57 NDFYPCSDNYVTAYLNLLEVQKSLHTKPTTW 149 NDF PCSD YVTAYLN EVQK+LH KPT W Sbjct: 345 NDFDPCSDYYVTAYLNRPEVQKALHAKPTNW 375 >ref|XP_003592242.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|357462115|ref|XP_003601339.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355481290|gb|AES62493.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355490387|gb|AES71590.1| Serine carboxypeptidase-like protein [Medicago truncatula] Length = 494 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = +3 Query: 18 DN*IQSFSVKLARNDFYPCSDNYVTAYLNLLEVQKSLHTKPTTW 149 D+ +++ S NDF PCSDNY AYLN EVQK+LH KPT W Sbjct: 331 DSSLKNGSTGYVTNDFDPCSDNYGIAYLNRPEVQKALHAKPTNW 374