BLASTX nr result
ID: Coptis21_contig00039412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00039412 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532784.1| pentatricopeptide repeat-containing protein,... 75 7e-12 ref|XP_002865170.1| pentatricopeptide repeat-containing protein ... 72 6e-11 ref|NP_568665.1| pentatricopeptide repeat-containing protein [Ar... 70 2e-10 dbj|BAD95174.1| hypothetical protein [Arabidopsis thaliana] 70 2e-10 gb|AAM67288.1| unknown [Arabidopsis thaliana] 70 2e-10 >ref|XP_002532784.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527472|gb|EEF29603.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 487 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/57 (63%), Positives = 45/57 (78%) Frame = -1 Query: 171 MFPRLYTRLLNITIHSLCKAQQLEKAETILVDAIRLGYFPNINTYNNLISAYSRIVS 1 M RL TRLLNI+I SLCKA++L KAE++++D IRLG P++ TYN LI AYSR VS Sbjct: 31 MVRRLSTRLLNISIASLCKAKELNKAESVIIDGIRLGVLPDVVTYNTLIDAYSRFVS 87 >ref|XP_002865170.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297311005|gb|EFH41429.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 468 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = -1 Query: 168 FPRLYTRLLNITIHSLCKAQQLEKAETILVDAIRLGYFPNINTYNNLISAYSRIV 4 FP + T+LLNI++ SLCK + LEKAET+L+D IRLG P++ TYN LI YSR + Sbjct: 8 FPGISTKLLNISVDSLCKFRNLEKAETLLIDGIRLGVLPDVITYNTLIKGYSRFI 62 >ref|NP_568665.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635755|sp|Q56XR6.2|PP421_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g46680 gi|332008030|gb|AED95413.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 468 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/55 (54%), Positives = 43/55 (78%) Frame = -1 Query: 168 FPRLYTRLLNITIHSLCKAQQLEKAETILVDAIRLGYFPNINTYNNLISAYSRIV 4 FP + T+LLNI+++SLCK + LE+AET+L+D IRLG P++ TYN LI Y+R + Sbjct: 8 FPGISTKLLNISVNSLCKFRNLERAETLLIDGIRLGVLPDVITYNTLIKGYTRFI 62 >dbj|BAD95174.1| hypothetical protein [Arabidopsis thaliana] Length = 468 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/55 (54%), Positives = 43/55 (78%) Frame = -1 Query: 168 FPRLYTRLLNITIHSLCKAQQLEKAETILVDAIRLGYFPNINTYNNLISAYSRIV 4 FP + T+LLNI+++SLCK + LE+AET+L+D IRLG P++ TYN LI Y+R + Sbjct: 8 FPGISTKLLNISVNSLCKFRNLERAETLLIDGIRLGVLPDVITYNTLIKGYTRFI 62 >gb|AAM67288.1| unknown [Arabidopsis thaliana] Length = 463 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/55 (54%), Positives = 43/55 (78%) Frame = -1 Query: 168 FPRLYTRLLNITIHSLCKAQQLEKAETILVDAIRLGYFPNINTYNNLISAYSRIV 4 FP + T+LLNI+++SLCK + LE+AET+L+D IRLG P++ TYN LI Y+R + Sbjct: 3 FPGISTKLLNISVNSLCKFRNLERAETLLIDGIRLGVLPDVITYNTLIKGYTRFI 57