BLASTX nr result
ID: Coptis21_contig00039302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00039302 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322258.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_002322258.1| predicted protein [Populus trichocarpa] gi|222869254|gb|EEF06385.1| predicted protein [Populus trichocarpa] Length = 229 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 348 ASHILLSMAGIKVRKHQPKMTQILLRFEDP 259 ASH LLSMAGIKVRKHQP+M QIL++FEDP Sbjct: 200 ASHKLLSMAGIKVRKHQPRMDQILIKFEDP 229