BLASTX nr result
ID: Coptis21_contig00039211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00039211 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003581127.1| PREDICTED: premnaspirodiene oxygenase-like [... 66 3e-09 ref|XP_003581036.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxyl... 65 7e-09 ref|XP_002323083.1| cytochrome P450 [Populus trichocarpa] gi|222... 65 7e-09 ref|XP_002323082.1| cytochrome P450 [Populus trichocarpa] gi|222... 65 7e-09 ref|XP_002323081.1| cytochrome P450 [Populus trichocarpa] gi|222... 65 7e-09 >ref|XP_003581127.1| PREDICTED: premnaspirodiene oxygenase-like [Brachypodium distachyon] Length = 503 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/54 (57%), Positives = 41/54 (75%) Frame = -1 Query: 236 PGMLFGSTVSEFALANLLYWFDLDLPGGANKEELDMSEAFGLSLNKKINLHVVA 75 PGMLFG++ E ALANLLY FD LP GAN + LDMSE FG+++ +K +L ++A Sbjct: 446 PGMLFGTSTMEIALANLLYHFDWVLPDGANPKSLDMSEKFGMAVGRKSDLKLIA 499 >ref|XP_003581036.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like [Brachypodium distachyon] Length = 508 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/54 (57%), Positives = 41/54 (75%) Frame = -1 Query: 236 PGMLFGSTVSEFALANLLYWFDLDLPGGANKEELDMSEAFGLSLNKKINLHVVA 75 PGMLFG++ E ALANLLY FD LP GA+ + +DMSE FGL++ +K +L V+A Sbjct: 447 PGMLFGTSTLEIALANLLYHFDWVLPDGASPKSIDMSEKFGLAVGRKHDLKVIA 500 >ref|XP_002323083.1| cytochrome P450 [Populus trichocarpa] gi|222867713|gb|EEF04844.1| cytochrome P450 [Populus trichocarpa] Length = 486 Score = 64.7 bits (156), Expect = 7e-09 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = -1 Query: 236 PGMLFGSTVSEFALANLLYWFDLDLPGGANKEELDMSEAFGLSLNKKINLHVV 78 PG LFG T EF +ANLLYWFD LP GA +EELDMSE G++ KK L +V Sbjct: 428 PGALFGVTAVEFMIANLLYWFDWRLPDGATQEELDMSEICGMTAYKKTPLLLV 480 >ref|XP_002323082.1| cytochrome P450 [Populus trichocarpa] gi|222867712|gb|EEF04843.1| cytochrome P450 [Populus trichocarpa] Length = 486 Score = 64.7 bits (156), Expect = 7e-09 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = -1 Query: 236 PGMLFGSTVSEFALANLLYWFDLDLPGGANKEELDMSEAFGLSLNKKINLHVV 78 PG LFG T EF +ANLLYWFD LP GA +EELDMSE G++ KK L +V Sbjct: 428 PGALFGVTAVEFMIANLLYWFDWRLPDGATQEELDMSEICGMTAYKKTPLLLV 480 >ref|XP_002323081.1| cytochrome P450 [Populus trichocarpa] gi|222867711|gb|EEF04842.1| cytochrome P450 [Populus trichocarpa] Length = 471 Score = 64.7 bits (156), Expect = 7e-09 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = -1 Query: 236 PGMLFGSTVSEFALANLLYWFDLDLPGGANKEELDMSEAFGLSLNKKINLHVV 78 PG LFG T EF +ANLLYWFD LP GA +EELDMSE G++ KK L +V Sbjct: 413 PGALFGVTAVEFMIANLLYWFDWRLPDGATQEELDMSEICGMTAYKKTPLLLV 465