BLASTX nr result
ID: Coptis21_contig00038998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038998 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513191.1| synaptotagmin, putative [Ricinus communis] g... 100 9e-20 ref|XP_002298449.1| predicted protein [Populus trichocarpa] gi|2... 99 3e-19 ref|XP_003534489.1| PREDICTED: multiple C2 and transmembrane dom... 93 2e-17 ref|XP_003539651.1| PREDICTED: multiple C2 and transmembrane dom... 92 6e-17 ref|XP_003605062.1| Phosphoribosyltransferase [Medicago truncatu... 90 2e-16 >ref|XP_002513191.1| synaptotagmin, putative [Ricinus communis] gi|223547689|gb|EEF49182.1| synaptotagmin, putative [Ricinus communis] Length = 1049 Score = 100 bits (250), Expect = 9e-20 Identities = 47/70 (67%), Positives = 55/70 (78%) Frame = -2 Query: 242 DDPTSLHQNNIEVCVYNDRKSFPGRNFLGKVRIHGSNIVKKGEEALQRFQLEKKWFFSSV 63 D +LH IEV +YN+R+ PGRNFLG+ RI SNIVKKGEE Q FQLEKKWFFSSV Sbjct: 57 DQNKNLHHQFIEVSLYNERRPIPGRNFLGRTRIPCSNIVKKGEEVYQSFQLEKKWFFSSV 116 Query: 62 KGEVGLKVYI 33 KG++GLK+YI Sbjct: 117 KGDIGLKIYI 126 >ref|XP_002298449.1| predicted protein [Populus trichocarpa] gi|222845707|gb|EEE83254.1| predicted protein [Populus trichocarpa] Length = 1051 Score = 99.4 bits (246), Expect = 3e-19 Identities = 44/69 (63%), Positives = 55/69 (79%) Frame = -2 Query: 242 DDPTSLHQNNIEVCVYNDRKSFPGRNFLGKVRIHGSNIVKKGEEALQRFQLEKKWFFSSV 63 D+ + H +IEV VYN+R+ PGRNFLG+ RI SN+VKKG+E Q FQLEKKWFFS+V Sbjct: 57 DETKNRHHQSIEVSVYNERRPIPGRNFLGRTRIPCSNVVKKGDEVYQTFQLEKKWFFSTV 116 Query: 62 KGEVGLKVY 36 KGE+GLK+Y Sbjct: 117 KGEIGLKIY 125 >ref|XP_003534489.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Glycine max] Length = 1060 Score = 93.2 bits (230), Expect = 2e-17 Identities = 44/64 (68%), Positives = 51/64 (79%) Frame = -2 Query: 224 HQNNIEVCVYNDRKSFPGRNFLGKVRIHGSNIVKKGEEALQRFQLEKKWFFSSVKGEVGL 45 H+ IEV VYN+R+ PGRNFLG+VRI SNIVK+GEE Q F LEKKWF S VKGE+GL Sbjct: 63 HRQTIEVSVYNERRLTPGRNFLGRVRIPCSNIVKEGEEVYQIFPLEKKWFLSPVKGEIGL 122 Query: 44 KVYI 33 K+YI Sbjct: 123 KIYI 126 >ref|XP_003539651.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Glycine max] Length = 1180 Score = 91.7 bits (226), Expect = 6e-17 Identities = 44/64 (68%), Positives = 50/64 (78%) Frame = -2 Query: 224 HQNNIEVCVYNDRKSFPGRNFLGKVRIHGSNIVKKGEEALQRFQLEKKWFFSSVKGEVGL 45 H IEV VYN+R+ PGRNFLG+VRI SNIVK+GEE Q F LEKKWF S VKGE+GL Sbjct: 63 HCKTIEVSVYNERRLTPGRNFLGRVRIPCSNIVKEGEEVYQIFPLEKKWFLSPVKGEIGL 122 Query: 44 KVYI 33 K+YI Sbjct: 123 KIYI 126 >ref|XP_003605062.1| Phosphoribosyltransferase [Medicago truncatula] gi|355506117|gb|AES87259.1| Phosphoribosyltransferase [Medicago truncatula] Length = 1165 Score = 89.7 bits (221), Expect = 2e-16 Identities = 46/71 (64%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = -2 Query: 242 DDPTSLHQNNIEVCVYNDRKS-FPGRNFLGKVRIHGSNIVKKGEEALQRFQLEKKWFFSS 66 D H IEV VYNDR+ PGRNFLG+VRI SNIVK+G+E Q LE KWFFSS Sbjct: 57 DTTKPYHHKTIEVSVYNDRRQPNPGRNFLGRVRIPCSNIVKEGDEVYQILPLENKWFFSS 116 Query: 65 VKGEVGLKVYI 33 VKGE+GLKVYI Sbjct: 117 VKGEIGLKVYI 127