BLASTX nr result
ID: Coptis21_contig00038492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038492 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266689.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 >ref|XP_002266689.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Vitis vinifera] gi|296090299|emb|CBI40118.3| unnamed protein product [Vitis vinifera] Length = 618 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = +2 Query: 2 WVEVENQVHEFHAGDGFHQISRKLDGIINLLKEDMKMKVFIPLTNF 139 W+E+ENQVHEFHAGD H IS+ + +INLL E+MK++ + P +F Sbjct: 572 WIEIENQVHEFHAGDVLHFISQDMCQVINLLNEEMKVEGYGPKVDF 617