BLASTX nr result
ID: Coptis21_contig00038418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038418 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531804.1| Root phototropism protein, putative [Ricinus... 135 3e-30 ref|XP_002269960.2| PREDICTED: BTB/POZ domain-containing protein... 134 6e-30 emb|CBI31167.3| unnamed protein product [Vitis vinifera] 134 6e-30 ref|XP_002323684.1| predicted protein [Populus trichocarpa] gi|2... 132 4e-29 ref|XP_003552325.1| PREDICTED: BTB/POZ domain-containing protein... 130 1e-28 >ref|XP_002531804.1| Root phototropism protein, putative [Ricinus communis] gi|223528538|gb|EEF30561.1| Root phototropism protein, putative [Ricinus communis] Length = 592 Score = 135 bits (340), Expect = 3e-30 Identities = 67/89 (75%), Positives = 79/89 (88%) Frame = -3 Query: 269 IPSLRAGDPLFNVDTVYRILVNFLQQIEDEESEEASHFGYESEGLGSPSRGSVLKVGQLI 90 IPS+R+GD LF+VDTV+RILVNFLQ++E+EE+E+ GYESEGLGSP GS+LKVG+LI Sbjct: 329 IPSIRSGDSLFDVDTVHRILVNFLQRVEEEENEDC---GYESEGLGSPGHGSLLKVGRLI 385 Query: 89 DAYLVEIAPDPYLDLQKFIAIIEILPDYA 3 DAYL EIAPDPYL L KFIA+IEILPDYA Sbjct: 386 DAYLAEIAPDPYLSLLKFIAMIEILPDYA 414 >ref|XP_002269960.2| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform 1 [Vitis vinifera] Length = 636 Score = 134 bits (338), Expect = 6e-30 Identities = 66/89 (74%), Positives = 81/89 (91%) Frame = -3 Query: 269 IPSLRAGDPLFNVDTVYRILVNFLQQIEDEESEEASHFGYESEGLGSPSRGSVLKVGQLI 90 IP ++ GD LF+VDTV+RILVNFLQ+IE+EE+EE +GYESE LGSPS+GSVLKVG+LI Sbjct: 362 IPCVQTGDSLFDVDTVHRILVNFLQRIEEEENEE---YGYESEALGSPSQGSVLKVGRLI 418 Query: 89 DAYLVEIAPDPYLDLQKFIAIIEILPDYA 3 D+YL EIAPDPYL+LQKF+A++EILPDYA Sbjct: 419 DSYLAEIAPDPYLNLQKFMAMLEILPDYA 447 >emb|CBI31167.3| unnamed protein product [Vitis vinifera] Length = 493 Score = 134 bits (338), Expect = 6e-30 Identities = 66/89 (74%), Positives = 81/89 (91%) Frame = -3 Query: 269 IPSLRAGDPLFNVDTVYRILVNFLQQIEDEESEEASHFGYESEGLGSPSRGSVLKVGQLI 90 IP ++ GD LF+VDTV+RILVNFLQ+IE+EE+EE +GYESE LGSPS+GSVLKVG+LI Sbjct: 328 IPCVQTGDSLFDVDTVHRILVNFLQRIEEEENEE---YGYESEALGSPSQGSVLKVGRLI 384 Query: 89 DAYLVEIAPDPYLDLQKFIAIIEILPDYA 3 D+YL EIAPDPYL+LQKF+A++EILPDYA Sbjct: 385 DSYLAEIAPDPYLNLQKFMAMLEILPDYA 413 >ref|XP_002323684.1| predicted protein [Populus trichocarpa] gi|222868314|gb|EEF05445.1| predicted protein [Populus trichocarpa] Length = 550 Score = 132 bits (331), Expect = 4e-29 Identities = 64/89 (71%), Positives = 78/89 (87%) Frame = -3 Query: 269 IPSLRAGDPLFNVDTVYRILVNFLQQIEDEESEEASHFGYESEGLGSPSRGSVLKVGQLI 90 IPS+R+GD LF+VDTV+RILVNFLQ++E+EE+E+ GYESEG+GSP GS+LKVG+LI Sbjct: 306 IPSVRSGDSLFDVDTVHRILVNFLQRVEEEENEDC---GYESEGIGSPGHGSLLKVGRLI 362 Query: 89 DAYLVEIAPDPYLDLQKFIAIIEILPDYA 3 D+YL E APDPYL LQKF A+IEILPDYA Sbjct: 363 DSYLAETAPDPYLSLQKFTAMIEILPDYA 391 >ref|XP_003552325.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like [Glycine max] Length = 596 Score = 130 bits (327), Expect = 1e-28 Identities = 64/89 (71%), Positives = 78/89 (87%) Frame = -3 Query: 269 IPSLRAGDPLFNVDTVYRILVNFLQQIEDEESEEASHFGYESEGLGSPSRGSVLKVGQLI 90 IPSL++GD LF+VDTV+R+LVNFLQ++E+EE+E+ +GYES+G S GS+LKVGQLI Sbjct: 333 IPSLQSGDSLFDVDTVHRLLVNFLQRVEEEETED---YGYESDGFCSSGHGSLLKVGQLI 389 Query: 89 DAYLVEIAPDPYLDLQKFIAIIEILPDYA 3 DAYL EIAPDPYL LQKFIA+IEILPDYA Sbjct: 390 DAYLAEIAPDPYLSLQKFIALIEILPDYA 418