BLASTX nr result
ID: Coptis21_contig00038281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038281 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523226.1| pentatricopeptide repeat-containing protein,... 69 4e-10 ref|XP_002868306.1| pentatricopeptide repeat-containing protein ... 63 3e-08 emb|CBI24313.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002267829.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|NP_193153.3| pentatricopeptide repeat-containing protein [Ar... 60 2e-07 >ref|XP_002523226.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537522|gb|EEF39147.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 488 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = +3 Query: 105 HGKSVHGWCVRRSLVSELSLGNALINMYVKCSAMVSAHCMFSVMPDR 245 HGKSVHGWCVR L ELSLGNA+++MY+KC + AH F MP+R Sbjct: 258 HGKSVHGWCVRNCLRLELSLGNAIVHMYIKCGMLAYAHRFFDKMPER 304 >ref|XP_002868306.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297314142|gb|EFH44565.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 458 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = +3 Query: 105 HGKSVHGWCVRRSLVSELSLGNALINMYVKCSAMVSAHCMFSVMPDR 245 HGKSVHGWC+RR L+LGNA+ +MYVKCS + AH +F MP R Sbjct: 234 HGKSVHGWCIRRCSCFGLNLGNAITDMYVKCSILDYAHTVFVNMPRR 280 >emb|CBI24313.3| unnamed protein product [Vitis vinifera] Length = 407 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/51 (54%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = +3 Query: 99 GW--HGKSVHGWCVRRSLVSELSLGNALINMYVKCSAMVSAHCMFSVMPDR 245 GW HGKSVHGW RR L L+LGNAL+ YVKC+A+ ++ +F MP+R Sbjct: 177 GWLKHGKSVHGWITRRCLALGLNLGNALVYFYVKCAALGYSYNLFDKMPER 227 >ref|XP_002267829.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14170-like [Vitis vinifera] Length = 455 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/51 (54%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = +3 Query: 99 GW--HGKSVHGWCVRRSLVSELSLGNALINMYVKCSAMVSAHCMFSVMPDR 245 GW HGKSVHGW RR L L+LGNAL+ YVKC+A+ ++ +F MP+R Sbjct: 225 GWLKHGKSVHGWITRRCLALGLNLGNALVYFYVKCAALGYSYNLFDKMPER 275 >ref|NP_193153.3| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635637|sp|Q5XEY7.2|PP309_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g14170 gi|332657989|gb|AEE83389.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 477 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/47 (57%), Positives = 33/47 (70%) Frame = +3 Query: 105 HGKSVHGWCVRRSLVSELSLGNALINMYVKCSAMVSAHCMFSVMPDR 245 HGKSVHGWC+RR L+LGNA+ +MYVKCS + AH +F M R Sbjct: 253 HGKSVHGWCIRRCSCLGLNLGNAITDMYVKCSILDYAHTVFVNMSRR 299