BLASTX nr result
ID: Coptis21_contig00038279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038279 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324841.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 ref|XP_002514352.1| transferase, putative [Ricinus communis] gi|... 69 5e-10 ref|XP_002282283.1| PREDICTED: hydroxycinnamoyl-Coenzyme A shiki... 68 7e-10 ref|NP_567826.1| HXXXD-type acyl-transferase-like protein [Arabi... 64 1e-08 emb|CAB79683.1| hypothetical protein [Arabidopsis thaliana] 64 1e-08 >ref|XP_002324841.1| predicted protein [Populus trichocarpa] gi|222866275|gb|EEF03406.1| predicted protein [Populus trichocarpa] Length = 399 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -1 Query: 139 MADITYLCKRTVVSTKPVQPGKYHSLSVLDHVMEPSNLRLIFYYYT 2 MADITY+CKRTVVSTKPVQPGK+ SLSVLD +ME ++LR ++Y+ T Sbjct: 5 MADITYICKRTVVSTKPVQPGKHCSLSVLDRLMEQNHLRSVYYFRT 50 >ref|XP_002514352.1| transferase, putative [Ricinus communis] gi|223546808|gb|EEF48306.1| transferase, putative [Ricinus communis] Length = 448 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/46 (63%), Positives = 40/46 (86%) Frame = -1 Query: 139 MADITYLCKRTVVSTKPVQPGKYHSLSVLDHVMEPSNLRLIFYYYT 2 MA++TY+CKRTVVSTKPVQPGK+ LSVL +ME ++LR+++Y+ T Sbjct: 1 MAEVTYICKRTVVSTKPVQPGKFFPLSVLGRLMERNHLRIVYYFQT 46 >ref|XP_002282283.1| PREDICTED: hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase [Vitis vinifera] gi|296081974|emb|CBI20979.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = -1 Query: 139 MADITYLCKRTVVSTKPVQPGKYHSLSVLDHVMEPSNLRLIFYYYT 2 MA+I+Y+CKRTVVSTKPVQPGK H LS LD M+ + +R+++YY T Sbjct: 1 MAEISYICKRTVVSTKPVQPGKTHPLSALDRAMDHNRVRIVYYYRT 46 >ref|NP_567826.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana] gi|332660207|gb|AEE85607.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana] Length = 460 Score = 63.9 bits (154), Expect = 1e-08 Identities = 24/41 (58%), Positives = 37/41 (90%) Frame = -1 Query: 130 ITYLCKRTVVSTKPVQPGKYHSLSVLDHVMEPSNLRLIFYY 8 + ++CKRTVVST+ ++PG+ + LSVLDHVMEP+++RL++YY Sbjct: 14 VRFICKRTVVSTRSIEPGRLYQLSVLDHVMEPNHIRLVYYY 54 >emb|CAB79683.1| hypothetical protein [Arabidopsis thaliana] Length = 414 Score = 63.9 bits (154), Expect = 1e-08 Identities = 24/41 (58%), Positives = 37/41 (90%) Frame = -1 Query: 130 ITYLCKRTVVSTKPVQPGKYHSLSVLDHVMEPSNLRLIFYY 8 + ++CKRTVVST+ ++PG+ + LSVLDHVMEP+++RL++YY Sbjct: 14 VRFICKRTVVSTRSIEPGRLYQLSVLDHVMEPNHIRLVYYY 54