BLASTX nr result
ID: Coptis21_contig00038224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038224 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA42763.1| TPA: hypothetical protein ZEAMMB73_123667 [Zea m... 88 8e-16 ref|XP_002535139.1| conserved hypothetical protein [Ricinus comm... 72 5e-11 >tpg|DAA42763.1| TPA: hypothetical protein ZEAMMB73_123667 [Zea mays] Length = 60 Score = 87.8 bits (216), Expect = 8e-16 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -1 Query: 122 MGRQWSAGKLVLILDAVHWNPAAPPRTLPRVRLRCGKAPP 3 MGRQWSAGKLVLILDAVHWNP APPRTLPRVRLRCGKAPP Sbjct: 1 MGRQWSAGKLVLILDAVHWNPEAPPRTLPRVRLRCGKAPP 40 >ref|XP_002535139.1| conserved hypothetical protein [Ricinus communis] gi|223523944|gb|EEF27245.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 122 MGRQWSAGKLVLILDAVHWNPAAPPRTLPRVRLRCGK 12 MGRQWS GKLVLILDAVHWNP APPRTLPRVRLR K Sbjct: 1 MGRQWSTGKLVLILDAVHWNPEAPPRTLPRVRLRSMK 37