BLASTX nr result
ID: Coptis21_contig00038211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038211 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK34006.1| unknown [Medicago truncatula] 60 2e-07 ref|XP_003600760.1| Wall-associated receptor kinase-like protein... 60 2e-07 ref|NP_001235056.1| protein kinase-related protein precursor [Gl... 60 2e-07 ref|XP_002311189.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002529875.1| kinase, putative [Ricinus communis] gi|22353... 59 5e-07 >gb|AFK34006.1| unknown [Medicago truncatula] Length = 631 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 320 PVLMEAASKVELETIKALAFLALSCLEEKRQNRPSMK 210 PVL AS +EL+T+KA+AFLAL CLEEKRQNRPSMK Sbjct: 577 PVLKNGASNIELDTMKAVAFLALGCLEEKRQNRPSMK 613 >ref|XP_003600760.1| Wall-associated receptor kinase-like protein [Medicago truncatula] gi|355489808|gb|AES71011.1| Wall-associated receptor kinase-like protein [Medicago truncatula] Length = 631 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 320 PVLMEAASKVELETIKALAFLALSCLEEKRQNRPSMK 210 PVL AS +EL+T+KA+AFLAL CLEEKRQNRPSMK Sbjct: 577 PVLKNGASNIELDTMKAVAFLALGCLEEKRQNRPSMK 613 >ref|NP_001235056.1| protein kinase-related protein precursor [Glycine max] gi|223452400|gb|ACM89527.1| protein kinase-related protein [Glycine max] Length = 649 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 320 PVLMEAASKVELETIKALAFLALSCLEEKRQNRPSMK 210 PVL A+ +ELET+KA+AFLAL CLEEKRQNRPSMK Sbjct: 593 PVLKNGATTIELETMKAVAFLALGCLEEKRQNRPSMK 629 >ref|XP_002311189.1| predicted protein [Populus trichocarpa] gi|222851009|gb|EEE88556.1| predicted protein [Populus trichocarpa] Length = 290 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 320 PVLMEAASKVELETIKALAFLALSCLEEKRQNRPSMK 210 P+L AS + LET+KALAFLALSC+EEKRQNRPSMK Sbjct: 243 PMLKVKASSLHLETVKALAFLALSCIEEKRQNRPSMK 279 >ref|XP_002529875.1| kinase, putative [Ricinus communis] gi|223530651|gb|EEF32525.1| kinase, putative [Ricinus communis] Length = 641 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 320 PVLMEAASKVELETIKALAFLALSCLEEKRQNRPSMK 210 PVL E+ASK+ELET+KAL LA +CL+EKRQNRPSMK Sbjct: 585 PVLKESASKLELETMKALGSLAATCLDEKRQNRPSMK 621